CAZyme Information: KAF5686637.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5686637.1
• CAZy Family: GH95
• CAZyme Description: periplasmic beta-glucosidase beta-xylosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	JAAQPE010000089|CGC1	66537.37	4.7486

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000089:40606-42525(+)

Full Sequence      

MWSSLLLLGGVSLSIANPIVRQDANPPYRNKTLCLDKRVDDLMSRMSLEDKAGQMFHGRT
VVVNNTFDETIEEFVTGKRITHYVLSGGVNDVRGVANWYNKLQRLAMSTPLGIPITISSD
PQHGWTDENAVSVVAQGFSRWTEPLGLAALRSPELVRQFAEMAREEYVAVGIRQALHPQV
DLATEPRWGRITGTMGEDANLTSALMVEYIKGLQGDKIGPNSVIATTKHFPGGGPMEDGE
DSHFPWGKNQTYPGNNRDYHLIPFKAAIAAGTRQMMPYYSRPINTSWEEVAFGFNKGVVN
DLLKKELGFDGIVVTDWGIVTTRFWGLEDQTELERARRVLEAGCDIFGGETKPELIIELV
NKGLISEARIDESVRKLMKEKFELGLFDNPFVDVDKAERIAGNDYFSRLGNETQRRAFTL
LTNKDDVLPLPLSALNAKFYIEGIEPEVMESRNLSVVENPEDADYALLRLASPFKPTTAP
GLPAMINNGSLEFNTTEKARQAKIYATLPTVVDIRLNRPAAVPEVAEQAVALFGSYGSSH
DAFLDVVFGTDGWGPEGRLPFDLPVSQEAADAQKEDVPFDVEALFKFGHGLRYKDTCDTL

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	107	346	1.4e-58	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.25e-60	46	445	1	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.62e-51	47	377	1	313	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	1.29e-35	36	434	35	411	beta-glucosidase BglX.
178629	PLN03080	1.07e-13	178	435	156	420	Probable beta-xylosidase; Provisional
235417	PRK05337	3.29e-06	136	346	73	276	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53531.1|GH3	0.0	1	599	1	599
QGI92047.1|GH3	0.0	1	599	1	621
QGI61148.1|GH3	0.0	1	599	1	621
CCT64822.1|GH3	0.0	1	599	1	621
QGI78326.1|GH3	0.0	1	599	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	7.04e-58	3	593	14	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
1LQ2_A	5.19e-41	28	591	5	597	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	5.37e-41	28	591	5	597	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGG_A	5.61e-41	28	591	9	601	Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGK_A Crystal structure of barley exohydrolaseI W434F mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6LBV_A Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6LC5_A Crystal structure of barley exohydrolaseI W434F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare]
6JGL_A	5.61e-41	28	591	9	601	Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGN_A Crystal structure of barley exohydrolaseI W434H in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGO_A Crystal structure of barley exohydrolaseI W434H mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6JGP_A Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	3.29e-246	21	597	35	626	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	5.38e-246	21	597	39	630	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	1.45e-238	10	595	19	617	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	2.19e-116	10	591	35	652	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	1.24e-39	28	595	29	640	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999721	CS pos: 16-17. Pr: 0.9640

TMHMM  Annotations     

There is no transmembrane helices in KAF5686637.1.