CAZyme Information: KAF5686614.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5686614.1
• CAZy Family: GH95
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		23384.67	4.9309

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000090:61294-62148(-)

Full Sequence      

MGMVTGFLSRNICHAAWSGKTIQYISDHITESLEQKPNLVLLHAGTNDMDLRPSISQEGN
DPKDAATRLGDLIDKIVRYCPDAVVLVAIPLASCDTEKPKMPIYRALIPGLVRQRRKDGD
HVIAVDFSTFDLGELRDCLHPTNEGYSIMGDYWYDFITQVPKGWIKEPIGDDPKREENGV
GRRILPDKMSILSVALYWGVYHIDDDVD

Enzyme Prediction     

No EC number prediction in KAF5686614.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	14	157	1.8e-30	0.7268041237113402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.97e-44	14	157	17	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.36e-11	15	146	39	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.84e-10	5	156	31	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	3.56e-06	14	153	47	224	GDSL-like Lipase/Acylhydrolase.
225353	TesA	0.002	34	157	75	208	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC66974.1|CE0	1.67e-98	15	202	129	313
QPC75718.1|CE0	3.38e-96	14	181	111	279
UPK97767.1|CE0	5.43e-75	2	198	97	291
QYS93131.1|CE0	8.10e-71	15	196	106	286
QPC73171.1|CE0	9.85e-71	14	180	102	269

PDB Hits     

KAF5686614.1 has no PDB hit.

Swiss-Prot Hits     

KAF5686614.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5686614.1.