CAZyme Information: KAF5686354.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5686354.1
• CAZy Family: GH88
• CAZyme Description: feruloyl esterase B precursor (subclass of the carboxylic acid esterase)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		32098.34	8.6435

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000096:43434-44379(+)

Full Sequence      

MLGLPSPRKLLTQLSLGASLVAAQLQTINNFGNTYGTNLIMQAYIPANRPANPAVVLALH
ACGGTGQGYFQQTQYKSLADQKGVILIFPSSQKDFNCWDVASTKTLKHDGQGDSQVLVSM
VDYVINTYKADRNKVYVTGTSSGCMMTNVLAATYPDRFAAATCYSGVAAGCMAGSPGSSP
ISSDRVCSDGKIIKTGQQWADRVKAMYPGYNGAYPRFKTWHGTADNLVFYRNLLEQIKEW
STLQGVSFSRNETNTPQSGYTTMIYGDGTKFVAVSAAGVGHVVPTHEDLDFKWFGLS

Enzyme Prediction     

No EC number prediction in KAF5686354.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	227	5.4e-27	0.7577092511013216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	7.15e-39	41	255	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.40e-22	44	284	52	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.58e-18	44	173	6	137	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	2.08e-08	55	166	193	302	Predicted peptidase [General function prediction only].
224423	DAP2	3.82e-06	44	167	383	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT72967.1|CE1	6.25e-210	1	297	1	297
QGI85778.1|CE1	6.25e-210	1	297	1	297
QGI99467.1|CE1	6.25e-210	1	297	1	297
QGI68577.1|CE1	6.25e-210	1	297	1	297
QKD62144.1|CE1	5.27e-202	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.42e-81	22	297	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HE18|FAEB_TALFU	3.41e-100	21	297	17	292	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	1.37e-95	22	297	18	292	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	2.26e-86	7	296	3	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|Q96W96|AXE1_ASPFI	1.77e-80	22	297	29	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q92194|AXE1_ASPAW	1.83e-80	22	297	30	304	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.787388	0.212612

TMHMM  Annotations     

There is no transmembrane helices in KAF5686354.1.