CAZyme Information: KAF5685605.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5685605.1
• CAZy Family: GH71
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1049	JAAQPE010000106|CGC2	118289.41	5.6346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000106:127845-131088(-)

Full Sequence      

MGDSIQHEPRGISLQEDPSRPDYINEAVFRRNTLPTRSYHIPDTSISLNGTWDFSLAGAV
LEAPEPGAKDVAYGQIQVPGHWQLQGHGKPWYTNVQYPIPVCPPYVPTENPTGTYRREFH
VPTGWAADSQLRLRFDGVDSAYHIWVNGTLIGYAQGSRNPSEFDVSSFVSREGPNELFVR
VYQWSDATYIEDQDQWWLSGIFRDVYLISFPAARIDDFFLTPHLDTDYKNARLDASVDVS
AQKGVIVELTVSELAKNGGAIIGSTEISFDRQSKATLSLDVEDPKKWTAETPYLYSAEIT
LKSADKQTVLHQVQQRVGFRTVELKDGLMKVNGKRIRLRGVNRHEHHPLLGRSVPLEFAK
RDLLIMKKHNINALRCAHQPHDPRVLDLCDEYGLWVMAEADLECHGFYDAVARPLDIPES
MDYGERKKLAFGKAAEFTSNNPKWKEAYLDRIRAVLNRDKNHASVIMWSFGNEAFYGDNH
REMFKYATEADPSRLIHYEGDMEAETTHMYSYMYPTVDRLIKYAEEEGVKDGKYEKPIVL
CEYGHAMGNGPGWLEDYEQAFRDHPRLQGGFIWEWANHGLWKDDHEGAGYYAYGGDFGDI
PNDGTFVMDGLLNSQHEPTPGLTEFKKVIQPVGFSFKDGELKIENWHDFAGLDHLTASYK
VEQFGQESTLIHSGSFDIPEIPAGETRSISLPVDAKRYNKDNEVYLTVTISLKHSTAWAS
AGHEIAWYQQQLQAPQTNAKAALAASNTLTSKFSVAEKGATVSVVGKNFEFVFDRAYGTL
KSWFSNNVTLLTSDPKTQAAIIPSFWRPKTDNDVPGAVPYWERFGVEQLQSQLRSFSVDA
SSSDKVIVKSHTFITPPVLFWGWDCEIEYTVYLTGALSVNVTRLSPTGSFPEHVPRIGLN
LYGSKTLEHVKWLGRGPGESYPDKKDSQRVGIWNVESVSELQTPYDVPQENGNREDTRWV
SLRDSKSPSIGLRAARLDGKNFSFLVSHHRDTTIHEARHPPDLKEDDAVFIRLDSKVAGV
GSGACGPAVREDLMVKTEETTFGFLLEPL

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	42	930	1.3e-222	0.964095744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	12	1021	6	998	beta-galactosidase.
236673	ebgA	0.0	48	1049	44	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	2.66e-162	46	932	13	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	1.15e-112	322	634	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	3.60e-86	766	1046	2	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74817.1|GH2	0.0	1	1049	1	1049
QKD60479.1|GH2	0.0	1	1049	1	1049
QGI70226.1|GH2	0.0	1	1049	1	1049
QGI87585.1|GH2	0.0	1	1049	1	1049
QGJ01115.1|GH2	0.0	1	1049	1	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	4.48e-252	8	1044	6	1027	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6S6Z_A	3.04e-188	39	1021	32	953	Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.13e-188	39	1021	33	954	Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6TSH_A	3.52e-180	9	1021	16	1011	Beta-galactosidase in complex with deoxygalacto-nojirimycin [Escherichia coli],6TSH_B Beta-galactosidase in complex with deoxygalacto-nojirimycin [Escherichia coli],6TSH_C Beta-galactosidase in complex with deoxygalacto-nojirimycin [Escherichia coli],6TSH_D Beta-galactosidase in complex with deoxygalacto-nojirimycin [Escherichia coli],6TSK_A Beta-galactosidase in complex with L-ribose [Escherichia coli],6TSK_B Beta-galactosidase in complex with L-ribose [Escherichia coli],6TSK_C Beta-galactosidase in complex with L-ribose [Escherichia coli],6TSK_D Beta-galactosidase in complex with L-ribose [Escherichia coli],6TTE_A Beta-galactosidase in complex with PETG [Escherichia coli],6TTE_B Beta-galactosidase in complex with PETG [Escherichia coli],6TTE_C Beta-galactosidase in complex with PETG [Escherichia coli],6TTE_D Beta-galactosidase in complex with PETG [Escherichia coli]
6ETZ_A	9.39e-180	31	1042	21	981	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	2.61e-251	14	1044	5	1020	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	1.07e-209	46	1049	42	1000	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q56307|BGAL_THEMA	1.61e-187	39	1021	33	954	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|O52847|BGAL_PRIM3	2.87e-184	47	1021	60	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
sp|A5F5U6|BGAL_VIBC3	3.32e-183	47	1021	49	990	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000005

TMHMM  Annotations     

There is no transmembrane helices in KAF5685605.1.