CAZyme Information: KAF5684695.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5684695.1
• CAZy Family: GH55
• CAZyme Description: exostosin-like 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		66930.90	8.1556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000124:18192-20487(+)

Full Sequence      

MLKPSNSSFMEKTLPLRNRVAEKIEWVKLRTPKVVKSRAFRRAATITSAVFFALTFIIVL
AKLTNAGFFIPKLVSHISRYPTCQSKGINGTRDIWEASQKKYENLMDDKFTIAMQTYRRP
KELQETLDIILSEEVPSLLEIVVVWNDLENYPPDDYVSKHGVPVRFRKSKRNSLNEKLWP
DPDYKTQAILLSDDDVYYHPNDLEFVFQTWRKFGRNRMVGALARCTPVDTFGYHKYTFCS
SRWGEDEYNMVLTNLAFSHVSFLDYYSSNDTIMTQIRDYVDEGFNCEDLAMNYVHGLLTG
EGPLLINGHEKYVNFVPKVGISMKKGHMEARSACLNDFSKMFGCHPLVNESGYIQRASQP
QILLLTPTMAMNPGEQTGVIISTAVVALLTGYAFGIYTIRGYLIPPSLFEERRRNLHDPV
ESDESDFDEDDTVLDHAPNWANGADADKRQGLKNVEKEKKPVLKDNGEECKLVLVVRTDL
GMTKVCVVGKIAAQCSHATLACYKALSRAPADSPLSKILKRWERLGQAKIAVQVKSQDEM
LELRRKARSLGITAEVIQDAGRTQIEAGSMTVLGVGPAPRSLVDQVTGGLKLL

Enzyme Prediction     

No EC number prediction in KAF5684695.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT64	110	351	3.2e-51	0.9637096774193549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396528	PTH2	2.74e-61	470	593	1	115	Peptidyl-tRNA hydrolase PTH2. Peptidyl-tRNA hydrolases are enzymes that release tRNAs from peptidyl-tRNA during translation.
239108	PTH2	8.28e-61	470	593	1	115	Peptidyl-tRNA hydrolase, type 2 (PTH2). Peptidyl-tRNA hydrolase (PTH) activity releases tRNA from the premature translation termination product peptidyl-tRNA, therefore allowing the tRNA and peptide to be reused in protein synthesis. PTH2 is present in archaea and eukaryotes.
239091	PTH2_family	8.92e-55	470	593	1	115	Peptidyl-tRNA hydrolase, type 2 (PTH2)_like . Peptidyl-tRNA hydrolase activity releases tRNA from the premature translation termination product peptidyl-tRNA. Two structurally different enzymes have been reported to encode such activity, Pth present in bacteria and eukaryotes and Pth2 present in archaea and eukaryotes.
401264	Glyco_transf_64	6.05e-54	110	352	1	237	Glycosyl transferase family 64 domain. Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.
224901	Pth2	1.81e-46	467	593	3	122	Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59433.1|GT64	0.0	1	593	1	527
QPC60493.1|GT64	0.0	1	593	13	618
QGI86326.1|GT64	1.86e-261	1	356	1	356
QGI99844.1|GT64	1.86e-261	1	356	1	356
CCT74021.1|GT64	1.86e-261	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Q7S_A	4.73e-30	469	592	2	116	Crystal structure of bit1 [Homo sapiens],1Q7S_B Crystal structure of bit1 [Homo sapiens]
7AU2_A	1.34e-27	104	348	628	864	Chain A, Exostosin-like 3 [Homo sapiens],7AU2_B Chain B, Exostosin-like 3 [Homo sapiens],7AUA_A Chain A, Exostosin-like 3 [Homo sapiens],7AUA_B Chain B, Exostosin-like 3 [Homo sapiens]
1OMX_A	4.49e-24	108	347	28	272	Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMX_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMZ_A crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1OMZ_B crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1ON6_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON6_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON8_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus],1ON8_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus]
1XTY_A	1.83e-23	471	593	3	120	Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase [Saccharolobus solfataricus P2],1XTY_B Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase [Saccharolobus solfataricus P2],1XTY_C Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase [Saccharolobus solfataricus P2],1XTY_D Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase [Saccharolobus solfataricus P2]
1RLK_A	1.32e-21	471	593	4	117	Chain A, Hypothetical protein Ta0108 [Thermoplasma acidophilum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13830|PTH2_SCHPO	2.21e-32	469	592	90	204	Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19A8.14 PE=1 SV=1
sp|P34222|PTH2_YEAST	2.22e-31	463	592	81	207	Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTH2 PE=1 SV=2
sp|Q8R2Y8|PTH2_MOUSE	2.73e-31	462	592	60	180	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptrh2 PE=1 SV=1
sp|Q9Y3E5|PTH2_HUMAN	2.99e-29	462	592	58	178	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1
sp|Q3ZBL5|PTH2_BOVIN	4.10e-29	462	592	58	178	Peptidyl-tRNA hydrolase 2, mitochondrial OS=Bos taurus OX=9913 GN=PTRH2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000012

TMHMM  Annotations     

Start	End
48	70