CAZyme Information: KAF5683868.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5683868.1
• CAZy Family: GH5
• CAZyme Description: dolichyl-P-Man:Man(5) c(2)-PP-dolichyl mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	JAAQPE010000137|CGC1	49578.79	9.9336

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000137:10293-11698(-)

Full Sequence      

MTESAPGTLSQGVRFLRNVLNGRHALSKLIPIALWLVDALGCGLIIWKIPYTEIDWVAYM
QQISQFVSGERDYTKMVGDTGPLVYPAAHVYTYTGLYYITDKGTNILLAQQIFAVLYMAT
LAVVMLCYWKAKVPPYMFIFLIASKRLHSLFVLRCFNDCFAVFFLWLTIFLFQRRQWTVG
SLVYSWGLGIKMSLLLVLPAIGVILFLGRGLWPSLRLARLMAQVQFAIGIPFITKNPRGY
AARAFELSRQFQFKWTVNWRMLGEEVFLSKYFAISLLACHALVLLIFISKRWIQPTGRSL
YDLIPSFLRLKSPFTMQEQLRISHYVTPEYVMTTMLTANLVGLLFARSLHYQFYAYLAWA
TPYLLWRATEDPIIVTIIWAAQEWAWNVYPSTDLSSTIAVNTMLATVVLVYLGTARLAVP
APAARVGNVDDKNK

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	33	396	1.3e-145	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	32	396	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63973.1|GT58	1.43e-307	1	434	1	434
QKD52612.1|GT58	6.86e-302	1	434	378	811
QGI91167.1|GT58	1.38e-301	1	434	378	811
QGI77460.1|GT58	1.38e-301	1	434	378	811
QGI60262.1|GT58	1.38e-301	1	434	378	811

PDB Hits     

KAF5683868.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	5.58e-186	3	413	9	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	1.11e-141	20	427	12	408	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.90e-136	20	407	20	396	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.62e-132	20	408	74	451	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	4.06e-131	20	407	12	388	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000007

TMHMM  Annotations     

Start	End
25	47
107	129
150	172
192	211
266	288
329	351
363	382
397	419