CAZyme Information: KAF5683763.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5683763.1
• CAZy Family: GH5
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1187		130479.71	5.0311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000138:74108-78090(+)

Full Sequence      

MQVKHRGPHWPLAAACLLLMSLTTAFENPDGTKPYGDGNAPDVVSFDPSWNESYPDSESQ
EHSLGADKGLSSRDNDFYLRVMPLGASITQGYLSTDNNGYRKWLRSQLRYKGWKVNMVGS
KQNGNMKDRDNEGWPGYVIDQVHNEFRKSMGMKPNLVLINAGTNDCNQKIDIDGAGGRMK
ALVDDIYSNIPGVTVVLSTIVRSTNVTNDACASKVSKQIRQLVKSYRGQRIGLADINPVL
PTSMLQKDGIHPTDAGYKLFASVWWDAISKVQADIQAPAKVSGIDDAVSEESSECKKTAG
NSRAPQQSQRGSGHDDGIYRHYSHAQGVLKSLRLENGGDSVSLIKDYPWHVFFANIVLNS
ANSPRSNALDDMIRIHHEQDGTNTYWYRQNQGGGKFSDSRMFDVDMDCNDGPRYAFADFN
NDGLDDFFCLKSGSAVWVSINQGGNPPKFKSIGQVVGKHDGYEATDVRIADIDGDGRADY
CLVEDNGAVICSRNAKGLRETVFDKNSKSGASKSGVVFADLNGDFRDEYIWVSDTGSVHT
WNNMRGWGKGIVPEWRDAGLTHKGQTAKDIQDRIKFGRIYGSGRRDYIYLRSDKTGIDMV
VWENKGFGGTKRKADGDFYCDMRGTGSDDYVWVYFDSHAAELNANIHNPPLWGNDLKIEL
KVPGPRVGIHLADWTGDGKCDVLVQNKATGALALYENTYKMGSKSVTFTNKGVVTPATCS
QGWGVSPFDRGMRLADIDGDGRADVMCLEPNGRITGWLNLKSGMENIGQVKFSEGRDRAD
IRFADVENSGRADIIYLDKYTGAATVFKNLGRKSGTGSSFNWSNRGVLYAPIDRGETMHF
TNQGGLGRADLVHVLPFTNKAYTYFNECGASSGDDGPIADPKLPKYSTGGQDGGTDDGSE
DGGGSDNECSKPTFDGDSKVILNENFPDPSFVFDPDSCTWYSFGSQDKGKLVQIARYDKA
KDKWELLDDDPLKDAGAWGQNLDIVAPDVIRDGGQWVMYYSAFTQDDHDGKRCIGVAFSD
SIRGPYTPRDEPLVCQLDKGEVIDPSAFYDPPSNTRWVVYKIDGNRICGKTSIMLQQVEN
DGFTLKNDPVEILSETDDEKLLETPSLVYEDGSYLLFYSSGCYTSDKYSIKYVTSGSISG
PYDREDNKVLGSIAGSIQSPGSASSNGNGHLLFGACYKFEDGQVTLD

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	925	1173	1.4e-75	0.939622641509434
CE3	79	268	2.1e-59	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350113	GH43_ABN-like	5.05e-88	921	1173	3	256	Glycosyl hydrolase family 43 protein such as endo-alpha-L-arabinanase. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
238871	XynB_like	1.29e-39	79	268	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
350102	GH43_ABN	1.20e-21	927	1170	1	242	Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350118	GH43_bXyl-like	6.60e-21	966	1164	48	221	Glycosyl hydrolase family 43 protein such as Bacteroides thetaiotaomicron VPI-5482 alpha-L-arabinofuranosidases (BT3675;BT_3675) and (BT3662;BT_3662); includes mostly xylanases. This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes that have been annotated as xylan-digesting beta-xylosidase (EC 3.2.1.37) and xylanase (endo-alpha-L-arabinanase, EC 3.2.1.8) activities, as well the Bacteroides thetaiotaomicron VPI-5482 alpha-L-arabinofuranosidases (EC 3.2.1.55) (BT3675;BT_3675) and (BT3662;BT_3662). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
398349	Glyco_hydro_43	1.64e-20	920	1164	4	239	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73237.1|CE3|GH43_30	0.0	1	1187	1	1215
AEO70515.1|CE3	2.86e-270	34	880	35	940
UDD56943.1|CE0	2.88e-175	58	891	32	869
EAA58486.1|CE0	5.90e-123	28	884	21	917
CCT65127.1|CE3	4.80e-117	70	886	40	907

PDB Hits     

KAF5683763.1 has no PDB hit.

Swiss-Prot Hits     

KAF5683763.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000717	0.999237	CS pos: 25-26. Pr: 0.9686

TMHMM  Annotations     

There is no transmembrane helices in KAF5683763.1.