CAZyme Information: KAF5683027.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5683027.1
• CAZy Family: PL4
• CAZyme Description: endochitinase 2 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873		90816.12	4.0482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000150:58133-60856(+)

Full Sequence      

MSSISFPGSSGLSLGLNGYWGQLGSDSLKSYCDSAPEYVTLSFVNQAPEHTESGYPGTNF
AGHCAAGVYSNKDGVASSLLSECYTIKEGIPYCQERGVKVLLSIGGVYNEAGSNYKVTTD
DKGVDFADFLYKAFGPYDQSWDGPRPFDSDDGTTRPSVDGFDFDIEHDLPNGPYIAMINE
LRRLNNDVIITGAPQCPTSDQYFYMKDMINQAKFDALFIQFYNNPSCDAIPDPSVSWDRF
NYDDWEGIVEDSACSQNAKLYVGLPASEAAAPGGGYLEPEAMKDLVCALKDKTHFAGISL
WDLTRGAGNEIDGKNYNEHVMDALKYGCDPVPVTTTTALTTTSEATSTAESTTTADTTTA
DVSTTTGVTATSDASSTDVSSTDVSSTDVSSTDASSTDASSTDASSTETATTSGLTTADT
TTASGVSSTEDSTASSDTSAATDVTSTLATSATSDASSATETTDGSATNVSGSVTDTTAS
ETSATATDSSADTTDTSATGSVLSTDTASATVDATATSDSSAITEDAATSTADATLESNT
ITETTRTTDSAQETESATAETIFSTFKGWNATYGAPSYTQKYGNPTTLIPSGTATITKGS
PVYTKYPDSTYAVSMTTSTVCTTRLHTAADGYVVTETIPLYTTVCPVTGKAKPTNYAVPS
QYETKTIYTTSVHTVTKCPPEVADCPYGSVTTETIPVYTTVCPVTEKSKPAPTDVLYDHE
IKTLYTSQVNTISHCAPGTRDCVVGAITTEIASWTTATVPAQQTQPIKIYRPVPEMPKIA
TKEAHYNGTVYASVAVPPVTLKTAAKPGVFQQAKPTHQQSSGAAAPTGGYTSVPASAPTY
APAPITPATAGASSLAAGLALMAGIVLFQALAL

Enzyme Prediction     

No EC number prediction in KAF5683027.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	1.86e-96	15	322	2	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	2.90e-10	94	315	60	274	Glycosyl hydrolases family 18.
411231	MSCRAMM_ClfA	4.48e-10	367	558	583	772	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	7.16e-10	372	556	610	796	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	2.82e-09	372	558	646	828	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69979.1|GH18	0.0	1	873	1	850
QGI96702.1|GH18	0.0	1	873	1	850
QGI65821.1|GH18	0.0	1	873	1	850
QGI83062.1|GH18	0.0	1	873	1	850
QKD55908.1|GH18	0.0	1	859	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	6.15e-64	19	324	6	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	6.33e-64	19	324	7	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	6.33e-64	19	324	7	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	2.70e-37	19	324	11	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
6IDN_A	1.26e-28	19	301	6	256	Crystal structure of ICChI chitinase from ipomoea carnea [Ipomoea carnea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	2.06e-61	19	338	34	348	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	1.42e-60	19	338	34	348	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|P54197|CHI2_COCP7	1.82e-52	19	336	34	348	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q1EAR5|CHI2_COCIM	2.46e-52	19	336	34	348	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2
sp|A2QUQ2|CHIA1_ASPNC	1.83e-51	19	332	33	343	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999338	0.000734

TMHMM  Annotations     

There is no transmembrane helices in KAF5683027.1.