CAZyme Information: KAF5681450.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5681450.1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	JAAQPE010000183|CGC1	24710.64	9.3270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000183:11755-12444(-)

Full Sequence      

MATSISPAVALPNIRVLPLGDSITKGTGSTGLVGYRLPLRQKILKQGVKVNMVGTLKNGN
MVDGHHEGHSGKMLADINGYWQKPIQARPNVVLIHAGTNNMDQGIDLDIAASILADIVDG
IFKVAPDVTICLAPVIWANDKEMQANTDKFNPQVRSLISARQKKGKHIIEVPIDIKKEDL
GDSKHPNDDGYEKMANAWLKAILEADKKGWLKMPVKMSPEDAPGTGLGA

Enzyme Prediction     

No EC number prediction in KAF5681450.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	14	202	6e-51	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.86e-49	14	202	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	8.26e-16	19	193	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.77e-12	16	201	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	9.90e-10	19	201	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
238865	sialate_O-acetylesterase_like1	6.49e-07	14	202	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC62878.1|CE3	1.44e-136	8	229	20	241
CEI70576.1|CE3	2.28e-136	1	229	16	244
QKD61617.1|CE3	1.06e-129	1	208	551	758
QKD52243.1|CE3	5.07e-87	5	228	20	246
CCT63634.1|CE3	5.32e-87	5	228	20	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.99e-15	10	204	2	197	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.60e-10	1	212	21	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5681450.1.