CAZyme Information: KAF5680199.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5680199.1
• CAZy Family: GH31
• CAZyme Description: xyloglucan endo-transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45171.78	6.3958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000197:117192-118376(+)

Full Sequence      

MRSLRKLLVLVLIAVTRAQDNASETKPQDWEADQCDCYLTDGIEPEYYTQHRFWDFRNLG
DYARIPDTIAGENASAEADVTSKYFKKKEWKDFWTIQSWSNRRSHDTLAYGARFPMVNSA
NNIYIRTNPDKNPASETYLSMRTNRQHDFQVASEFDLIDRFQFLSIRFLGRVRGAPGACM
AMFTYVPAAEIKNVQEADMEILTREDYDRVHYTNHPGYSIEGEVYPKATRNTTLSGELKW
NKWVEHRLDWTLSQSIWYANGKQVANISFQVPRDPSLMIFNTWGDGGVWTQNMTTGEEAY
MEMQWLQLLYNTSDASAKHKRDDAGPKGRVLRKRGDENVCRMVCGIDQEDGAGVVTWLWG
NNTASSLLSGRSVGASFGGLITWVLGLVILARWI

Enzyme Prediction     

No EC number prediction in KAF5680199.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	92	307	1e-86	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	6.69e-46	88	305	7	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99398.1|GH16_22	1.24e-276	4	394	4	393
CCT72886.1|GH16_22	1.24e-276	4	394	4	393
QGI68506.1|GH16_22	1.24e-276	4	394	4	393
QGI85704.1|GH16_22	1.24e-276	4	394	4	393
QKD62064.1|GH16_22	2.78e-271	1	394	1	394

PDB Hits     

KAF5680199.1 has no PDB hit.

Swiss-Prot Hits     

KAF5680199.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999766	CS pos: 18-19. Pr: 0.9780

TMHMM  Annotations     

Start	End
372	391