CAZyme Information: KAF5679693.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5679693.1
• CAZy Family: GH3
• CAZyme Description: endo-xylogalacturonan hydrolase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	JAAQPE010000205|CGC1	43407.72	6.0294

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000205:157817-159037(-)

Full Sequence      

MLFQSVFFVPLLSLVTQGVAGTPTSHDHSLVHHKRATCTPKSAGSASTDDVPAIVAALKQ
CGNGGVIVFPKDTTYMIRSKLSFAGCTNCEVQLDGRLKLSDDYTFWNNSRTQIDIRGING
LKLHSPAGTGQIDGNGQAAWDRFGSVGDLKRPVLFAVEGSTDVEVNGFLMKNAQNVFVDI
GSNSERVKFLNMDLTAISKSSYPPKNTDGFDIGASKYTTLSNIFIQNDDDCVAFKAGCDK
VTVTDITCQGSHGLSVGSLAKTNTDTVTNVYVRNATMIGATKAAGIKIYPGGPDHGTAIV
RNVTWDGVIVDNCGAAFEFDACYNEDESYCEQHPSTAQVTEIYVKNFSGKTSTKYAPTTG
HVYCPVEGKNCDVEFTNWTVKSGTGAGQFLCENISSDVLGITCKAP

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	59	397	6.5e-61	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.62e-32	61	396	1	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	1.23e-31	44	358	77	389	polygalacturonase ADPG
215120	PLN02188	3.29e-29	1	400	7	396	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	6.12e-26	42	356	31	336	Probable polygalacturonase At3g15720
215540	PLN03010	3.59e-25	44	358	56	355	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60538.1|GH28	3.97e-293	1	406	1	406
CCT74772.1|GH28	1.07e-280	1	405	1	401
QGI70183.1|GH28	2.15e-248	1	381	1	377
QGI87543.1|GH28	2.15e-248	1	381	1	377
QGJ01072.1|GH28	2.15e-248	1	381	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.18e-130	33	405	14	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVE_A	1.09e-25	34	403	7	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.49e-25	34	403	7	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	3.11e-24	36	403	1	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1IA5_A	1.21e-17	118	403	76	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UBD8|XGHA_ASPOR	3.62e-131	4	405	5	402	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1
sp|B8NPS8|XGHA_ASPFN	5.13e-131	4	405	5	402	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q9UUZ2|XGHA_ASPTU	5.88e-130	2	405	3	402	Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis OX=5068 GN=xghA PE=1 SV=1
sp|A2QK83|XGHA_ASPNC	9.54e-129	2	405	3	402	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xghA PE=3 SV=1
sp|Q5B7U1|XGHA_EMENI	1.99e-126	35	385	28	377	Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000520	0.999448	CS pos: 21-22. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in KAF5679693.1.