CAZyme Information: KAF5678228.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5678228.1
• CAZy Family: GH28
• CAZyme Description: glycosyl hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	JAAQPE010000215|CGC1	33474.27	9.9048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000215:5543-6501(+)

Full Sequence      

MKLFGSIGAVAAALMLLPGQALAGQYKGFSMSANRADGACKYTADWKKDFQTIKSWNKGF
NAVRLYSADDCNTLVKAVPAAKQTGMKILVGVWATDDAHFGRDKAALLKVIKQYGTDWIA
AISVGSEDLYRKDISPDKLAQQIYDVRGMVRQFNKNLKVGHTDTWTAWVDGRNDVVSKAC
DIAITNGFPYWQGVAIKDALQKKTFQNSYWSVQKHVKAVNSKAAVWVGETGWPTKGPNYQ
KAAATTASLQSYYNNVGCWLWQQKDASGFWFTAFDAPLATPEVEKYFGIANKDRKLKFTL
TC

Enzyme Prediction     

No EC number prediction in KAF5678228.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	57	302	1.6e-31	0.9196141479099679

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.26e-59	18	294	37	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.51e-17	29	302	5	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74252.1|GH17	1.56e-226	1	302	1	302
QGI87033.1|GH17	1.56e-226	1	302	1	302
QGJ00576.1|GH17	1.56e-226	1	302	1	302
QGI69688.1|GH17	1.56e-226	1	302	1	302
QKD61100.1|GH17	4.13e-222	1	302	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.41e-31	37	301	46	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.98e-30	37	301	46	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	6.43e-64	29	302	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	8.70e-49	1	302	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	4.36e-42	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	4.68e-42	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|P43070|BGL2_CANAX	3.79e-41	29	302	24	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999716	CS pos: 23-24. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in KAF5678228.1.