CAZyme Information: KAF5677443.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5677443.1
• CAZy Family: GT8
• CAZyme Description: glycosyltransferase family 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		74482.46	6.1377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000224:9121-12021(+)

Full Sequence      

MRVFLIQTAKGLFSSSGGYKANNALLRYLSSRGHCVRQLCYSYRGEVESYMDNNDEVDSR
LRTRSLHIRSESGKPGQDIQVHDLCMEDGVEALALDSKAFDAAFGGKVESSNTLARMSAE
YIENGTSSAPLMDFIAFLQEEIRRFSPTHIISNDGLSMKASLAPELAHLTMSRIAVVHTA
EQLPFGPFAGGLPGHSSTTRETDLFQRLDGIWSVSETIRKYALEHGQLETRFLVLHPWTY
LVGKDHAIPDRVFNWDKKFVGMINPCPVKGASILVDLARKCPQLEFLTYMSWGADEATVK
DMGDLSNMTVRPSCTSAKDLWRDIKVLVVPSLWCEAWGMVVVEAHLRGIPVVSSNAGALS
ESMLGLDYIIPVTSITGVRDESGRYMIPEQDVAPWVKVITNLMQDQCDYEKVSTQGIRHK
TWGYLFTMFCGHVLEIVGFAARIAMHFGQGGFLTYIVTITIGPAFFSATIYLCLARIITV
YGQSYSRFSPRTYTITFMLFDFVALVLQATGGSMLGSDERDTINVGLKVIQTGLAAHLAA
ISIFVILASELAFRIFRHQEDWDPRFRQLQPSWRFNLFLACLTIATVTILIRTSYRVAEL
SLGYHSDLAENEIAFMLLEGMMVVIATTALAIGHPGPSFQGRYEDADFQLKKAGDVEDPS
KSDSNSLELS

Enzyme Prediction     

No EC number prediction in KAF5677443.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398267	RTA1	2.42e-76	428	642	1	210	RTA1 like protein. This family is comprised of fungal proteins with multiple transmembrane regions. RTA1 is involved in resistance to 7-aminocholesterol, while RTM1 confers resistance to an an unknown toxic chemical in molasses. These proteins may bind to the toxic substance, and thus prevent toxicity. They are not thought to be involved in the efflux of xenobiotics.
340850	GT4_ExpE7-like	2.08e-20	136	421	86	343	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
340831	GT4_PimA-like	2.62e-11	134	419	70	347	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	4.38e-08	130	419	69	356	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
404563	Glyco_trans_1_4	2.14e-07	259	405	6	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50346.1|GT4	6.40e-248	1	413	1	416
CAE6996711.1|GT4	9.51e-184	1	415	30	447
CAE85589.1|GT4	6.54e-103	1	413	24	433
AEO63904.1|GT4	1.08e-99	1	414	2	385
AEO58675.1|GT4	1.47e-98	1	413	12	391

PDB Hits     

KAF5677443.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2Z5TTA9|HIME_ASPJA	2.91e-57	416	657	50	299	Efflux pump himE OS=Aspergillus japonicus OX=34381 GN=himE PE=3 SV=1
sp|A6ZNQ4|RSB1_YEAS7	3.52e-27	415	642	53	311	Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=RSB1 PE=3 SV=2
sp|B3LJA1|RSB1_YEAS1	3.52e-27	415	642	53	311	Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=RSB1 PE=3 SV=2
sp|B5VRU8|RSB1_YEAS6	3.52e-27	415	642	53	311	Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=RSB1 PE=3 SV=1
sp|Q08417|RSB1_YEAST	3.52e-27	415	642	53	311	Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSB1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
421	443
453	475
495	517
532	554
575	597
612	634