CAZyme Information: KAF5676468.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5676468.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	JAAQPE010000234|CGC3	26413.94	5.2253

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000234:12405-13121(-)

Full Sequence      

MMLIQSSLVALALFTTSCTAISKNFYPSSKRGLIYIPNSDFPSDDKVWVQKHSDLTWYYN
YKPHPSPVYENNTSLQFVPMLWGAPDGFDDTSFLENVTAQIIGGRNISYVMGFNEPDNSM
ANGGSDMKAKDAARYWIKQLEPLRKLGVSLGAPAVTGAPSGFTWLADFVEACKGNCTFDF
IPIHWYGSFDGMASHIAGVLDVFPGKKIWVTEFALDFSSLAATQDYFQTSVKYLDGNK

Enzyme Prediction     

No EC number prediction in KAF5676468.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	49	237	8.2e-56	0.8169642857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	6.83e-59	42	237	5	197	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68614.1|GH128	1.10e-173	1	238	1	238
QGI99504.1|GH128	1.10e-173	1	238	1	238
CCT73008.1|GH128	1.10e-173	1	238	1	238
QKD62181.1|GH128	1.07e-169	2	238	1	237
APA13134.1|GH128	1.79e-75	28	235	30	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	1.63e-18	28	213	2	177	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	2.73e-18	28	213	33	208	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB2_A	2.10e-16	28	236	23	220	Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_C Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_D Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB3_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB3_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB4_A Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB4_B Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB5_A Crystal structure (P21 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB6_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritetraose [Lentinula edodes]
6UBD_A	2.03e-11	55	217	50	206	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]

Swiss-Prot Hits     

KAF5676468.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000507	0.999492	CS pos: 17-18. Pr: 0.9533

TMHMM  Annotations     

There is no transmembrane helices in KAF5676468.1.