CAZyme Information: KAF5676467.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5676467.1
• CAZy Family: GH18
• CAZyme Description: interferon-induced GTP-binding Mx2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027		114425.53	6.1639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000234:8012-11417(-)

Full Sequence      

MDSGMSQRSVSMSGAVANGSIRHVTGLSLGASTPVPVVAIIGDKGCGKTSLFEALSGLSL
HGSQLSSTTFPIHACFTHSSRTGTTLKARIKPGKTDGQNAELSDHLQSFEVNYEGDLAAV
NLPQIVNQATNHMQVATAFSDEKEQEELQVSDNVLIIEISGPDFFSMEIVDTPGLSSSPL
VDDTQEITRSLIMDLVKQPNTIILSVLDATSDMSTQEGPRLARAADVTGNRIVAVVTKCD
LVLPDERRFVLRAIRNKERHLGHPWFATRSLSSDERDQNCTLETRNSVEDSFFSEMEWAI
LKRRRRVGAPALKDHLKTRVNVMLRGSIDLLTTILNTPSHSVAPTRAPSFTEKAQPTNVY
ATSQETVVADVDLEFASDAPRPTPLLNAVIVGLTVAICLCLIGLGCSAMALEVASEGRWY
RFFLLVTALPQIVLSLFFCQAIVVTIFQMVGPVTQLKVNSKFYSAKRTKRLDGTKVVLPH
VTIQCPVYKEGLEGVIRPTVQSLNAAIRNYESFGGTASIFINDDGMQLVSPEEAEERRMF
YKENNIGWVARPGHNVNGEGIKRFIRRGKFKKASNMNYALGISLKVEDKLVEIVRGEKWT
QVHESQAYQKCLDEVLAEELGRAWVGGDIRVGDYLLLVDSDTRVPTDCLIDAVSELEASP
RVAILQFTSGVMNVTTSYFESGITFFTNLIYTAITYAVANGDVSPFVGHNAFIRWSALQE
VGSQDGGIIDNEKDPNATTPYEKFWSESHVSEDFDISLRLQTLGYHIRLGAYCGDGFKEG
VSLTVYDELARWEKYAYGCSELLFWPIKDWWRHGIFTPLFKRFIWSNMPLGSKITIMSYI
GTYYAIGYSWIGSLLNYFLIGWLNGELDHYYMSSWRVWVALVVVFSIAGNITLALIRYRS
QQVSLLKELWTCFKWVALMFIFLGGISMHVCKAILCHMLSIDISWGATSKEAEDTNFFQE
ISIIIAGFKYVFIFCLAVTALMICGVYAFPYLWRIDELVAIFPLATVIFCHFFLPIALNP
NLMKFTW

Enzyme Prediction     

No EC number prediction in KAF5676467.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	634	859	3.9e-50	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
206738	DLP_1	7.73e-47	34	316	2	265	Dynamin_like protein family includes dynamins and Mx proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.
404513	Glyco_trans_2_3	3.25e-45	634	860	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
395279	Dynamin_N	2.25e-17	38	238	1	167	Dynamin family.
224136	BcsA	9.55e-16	632	953	138	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
197491	DYNc	5.21e-11	28	257	17	218	Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73007.1|GT0	0.0	12	1027	1	1016
QGI99503.1|GT0	0.0	12	1027	1	1034
QGI68613.1|GT0	0.0	12	1027	1	1034
QKD62182.1|GT0	0.0	133	1027	1	912
QGI85813.1|GT0	0.0	366	1027	5	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4P4S_A	8.95e-14	35	331	13	285	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4S_B	1.07e-13	21	331	14	300	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4T_A	1.22e-13	21	331	20	306	GDP-bound stalkless-MxA [Homo sapiens]
4P4U_A	1.25e-13	21	331	20	306	Nucleotide-free stalkless-MxA [Homo sapiens]
5GTM_A	7.69e-13	21	331	24	310	Modified human MxA, nucleotide-free form [Homo sapiens],5GTM_B Modified human MxA, nucleotide-free form [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P18588|MX1_RAT	1.10e-15	21	343	47	344	Interferon-induced GTP-binding protein Mx1 OS=Rattus norvegicus OX=10116 GN=Mx1 PE=1 SV=1
sp|A7VK00|MX2_PIG	4.33e-14	21	331	101	385	Interferon-induced GTP-binding protein Mx2 OS=Sus scrofa OX=9823 GN=MX2 PE=2 SV=1
sp|P33237|MX1_SHEEP	6.92e-14	21	331	51	337	Interferon-induced GTP-binding protein Mx1 OS=Ovis aries OX=9940 GN=MX1 PE=1 SV=1
sp|Q28379|MX1_HORSE	9.19e-14	21	331	56	342	Interferon-induced GTP-binding protein Mx1 OS=Equus caballus OX=9796 GN=MX1 PE=2 SV=1
sp|Q6PW23|MX_EPICO	1.15e-13	21	295	19	268	Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

Start	End
388	410
422	444
839	861
874	896
909	931
971	993
998	1020