CAZyme Information: KAF5675340.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5675340.1
• CAZy Family: GH17
• CAZyme Description: class I alpha-mannosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	JAAQPE010000242|CGC2	61360.87	6.8298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000242:12231-14016(+)

Full Sequence      

MQRSVQKAIVWLGAIFVAYHVFSLLFAGRASRNGYSKTASHQAHAKLKGDPQRAAAIVEA
FRFSWDKYEQFAAPHDTLLPISETYEDDRNGWGATAVDGLSTAIIMEDAEIVDKILRQVM
LTDFTKTVVPNQPISLFETTIRYLGGLLCAYDLLSGSYKHLATDIYLKNNLLKTAVILAD
RLSIAFDTPSGIPDDEIIFNPQLRRFGNIDNSITCFGTLVLEWTRLSDLTGNQTYAKLAQ
RAQDHLIHPKTKQSFTLPGLIGTYVKLKDGYFGDYQAGWGGGSDSYYEYLIKMYAYDPVA
FAEYGESWIKAAESSMLYLASSPSTRPDLTFLGEMRGDTMIPISSHLASVCGGSLILGGL
LLQNQTFVDFGVKLSESYYEVYRQSPSGIGPELFRWVDDGRQPLAKASAKRLPAPKWQSF
YEKSGYYHTNAEYILRPETIESLYYAYRATGDRKYQDWAWEAFEALNRMCKVEGGYTGLK
SVMKTRDDKTRKFVDKMESFWLAETLKYLYLMFAEDSELQVRSDGKMKYVLNTEAHPLLI
RGK

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	60	538	5.6e-127	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.50e-167	60	540	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.28e-105	53	540	72	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI86808.1|GH47	0.0	1	543	1	543
QGJ00339.1|GH47	0.0	1	543	1	543
QGI69450.1|GH47	0.0	1	543	1	543
CCT73833.1|GH47	0.0	1	543	1	543
QKD59969.1|GH47	0.0	1	543	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	1.85e-176	50	541	12	493	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1KKT_A	8.95e-145	17	540	5	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	1.56e-144	53	540	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
5KIJ_A	9.97e-62	53	540	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.15e-61	53	540	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	4.83e-151	53	541	39	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	5.92e-148	44	540	33	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|B8N417|MNS1B_ASPFN	3.04e-147	35	540	22	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	3.04e-147	35	540	22	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|Q12563|MNS1B_ASPPH	9.51e-147	44	540	33	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999661	0.000364

TMHMM  Annotations     

Start	End
9	28