CAZyme Information: KAF5674471.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5674471.1
• CAZy Family: GH16
• CAZyme Description: lipolytic G-D-S-L family

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1380	JAAQPE010000250|CGC1	151348.87	4.8128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000250:69687-74931(+)

Full Sequence      

MQRLRYALALFAAAGSAVARPSLVDYGSMSMNNIFGRETTDFFNPDDLTFIKKLAAVGDS
YSAGIGAGDGLHGEGDENCRRYDHSYPYLINQDERLGDAANRKFQFKSCSGAVIKNVIED
QLPSIDSDQQIILLSAGGNDAELVNILNQCVYQWFALNGQQSTVGQLQYSKNIINTDEFS
KRIDSMIEATKKKLSSEYAKFWSTDYGSACDKVSWSTWIFKSYNIWQPAARLEELRRREM
NRLVDLINDKIEAAVKRAGNKVTFINYDEYVGHFKGRYCEDGVDESVVDSNTRPELMFYE
LDTFDPWGNRPWKRSTVEHQNGSFSGDMNTMARAAEFVAPDVTFRQEHKIEDDSEIQGLQ
AAAKEGATEDVPNLLPDGYGRVFHPQILLHELIANLVLFEVSNRRMEENDMAPEPLLDTS
VAQCPINPSGNIVLKYKETKPGEAVKKGTELRILPLKEDLSGDKVVFAGTESSGTMTDGN
YAAWSGKTIQYISDHVDSSLKQRPNIILLAAGTNDMNPNHGISKEGNDPKGAADRLGKLI
DKMVKACPDATILVAMIINTCDEKQSPATKEFQKLVPGVVRSRHDDGQHVLAVDFTTFKT
SDLQDCIHPTNDGYKLMGDYWYSFIHQIPSSWIKKPVGPDPSGGDGTNGGIDKNIPAPDW
GKSPIQVTSKKTVADAAKYATGGKYKYVTCNGNPWYKGTGKIAQGGVGKNGDWKYHKDWK
AEGQVAEGLGLDNQYVRLHDMNGDGKADYVWIHPKTGEITCWLNNLPKPWSKAGNNNGII
GSGVGPAKTIYLADMNGDGMDDYLVVDPDNGSVRVWWNYGPDDSWDNGWKFVPGGEIASG
LPHANLETLRFPDINGDGRADYVYIGEGGSLKHHLNTGSVGGRDVLFHAMGGIATGAVSD
ISKLVFADMNGDGRDDYLIWDEDGGLTGFLNQPTNREGVPLFVNQGPAKTIADGIKKKPS
TIRLADMDGDGKDDYVYVGDHGALSVWYNRGTTDDSMAIDGLRFADMDGDGVDDYVWLDP
KTGAPTVYLNSGVNDGDSLGWAWSPINGGKPIASGAAPANQVVFGDINGDGLDDYLDLDP
KTGLLKAYLNLGRESDWKFRPIGTIASGLGPGKRVRIADIDGDGRDDYIFLKDNGGTTIY
CNIYGPDNDGDKYAPMSDADASGINQSPDEIDFIDMNGDGKADYVWTSRLDGSVKVWYND
YPKKPTWREAGEVAGGVGTSGANIRYAKLQKTGRYDYVAVDPKTGAIAAWLNGCGDPDTS
KKKHRITIARYLTKVWLIMEKPVDKDFSSDTCVKTGKGGDTRGTPILNTTAEDKFPAALK
SGDTMEKLYGNTCFYEGSTDRVGKLVCDGVSGIRCYEDENFGKTQKCRFGSYTYALYCEW

Enzyme Prediction     

No EC number prediction in KAF5674471.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	462	625	2.5e-38	0.8350515463917526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.64e-48	451	625	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238861	SEST_like	3.20e-29	52	297	1	238	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
404371	Lipase_GDSL_2	5.44e-11	480	616	37	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.34e-08	482	624	41	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	3.84e-06	966	1017	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67685.1|CE0	0.0	1	1380	1	1436
QGI80975.1|CE0	0.0	1	1380	1	1437
UMZ45332.1|CE0	0.0	41	1380	41	1455
QPC64279.1|CE0	0.0	419	1380	16	844
UQC90643.1|CE0	0.0	434	1361	342	1309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	1.26e-12	56	196	7	134	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	7.17e-09	56	153	6	96	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]
6SUP_A	9.70e-08	792	990	422	606	Crystal Structure of TcdB2-TccC3-Cdc42 [Photorhabdus luminescens]
6H6G_A	9.72e-08	792	990	453	637	Crystal Structure of TcdB2-TccC3 without hypervariable C-terminal region [Photorhabdus luminescens]
4O9X_A	9.73e-08	792	990	487	671	Crystal Structure of TcdB2-TccC3 [Photorhabdus luminescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	2.20e-09	56	153	40	130	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	3.11e-08	12	153	8	130	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999710	CS pos: 19-20. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in KAF5674471.1.