CAZyme Information: KAF5674393.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5674393.1
• CAZy Family: GH16
• CAZyme Description: glycoside hydrolase family 18

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1152	JAAQPE010000251|CGC1	123943.43	4.7566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000251:12640-16551(-)

Full Sequence      

MLLDFAIFSPLDDPSSVIKLRTCAAGDGSNSQTAPLSSSVPSAGKRAIKDTFSDTSCITA
SGSEVDLEMLVSSSESTVPSTHLDSALSALEQYMSSSTHCQTKFLVGYSQGVVVAIHSGD
AIDNGRTIPSIMNQVKSHLDSASPSNAIAELCGDDRNADYTFGIAIDTTGDLASVQKAIA
SWSNGTCFSTGQPTAKLSGVKIFEAPLIPLSHGNSTKRSARSHKHTHGNGLTVEQIEKFN
DKTTWGWNGCKSLAAGINICLSTGTPPLPAPVSNALCGPLKPGTAAPKKGQSLADLNPCP
LNSCCDIWGQCGITPDYCMAEKGLTGNPGTAPPKKNGCVSNCGIDIKNNSDKPTEFIKIA
YYESWNWDRPCLNYRAINLGGTTYTHAHWGFATLDNSYNVVVNDTYKQLEDFLSLPNKKI
LSFGGWGYSTDPKTFESLRTAMNPANVDKFVANIASYLKKGWDGVDIDWEYPGAPDIPGI
PLGLKTDGPNYLNFLQKLCKAVGTSKSISIAAPASYWYLKAFPIADMAKVVDYIVYMTYD
LHGQWDYKNIWAQDGCSSGNCVRSHVNLTETTYALAMITRAGVAASKINVGVASYGRSFG
LTSRHACEKSLSDSGFHIMGPKSGATPGNCTQTAGYISNAEIEEVMDLNTTGAGVDYIYD
KASDSDTLFYGNNWVAYMSDTTKKSRIAHYQGLNFGGTVDWAVDLQQFTDDDLDPEGDDD
LPDTTPLSACSATYSTFEDLDAHASSIPQHCVAQYTITTLRAFLTETLNNYTTLLSDGYD
KKFGIYSKAVAGSASQSLLGFIDDHGNDYATCIVAETSICCKACNDDKKSDSYCDYCFDG
KCYHECNVLGCTNKRDDVQPSQELIVKTANESEPCPPNYSKRGYGPDNPYEQTVYWTWKN
SSGFFADLELNTGIPKSKTKMGNYDRMNSCAPSAKAGDDCWSIGMYYNMPLINGYSASDV
ANPKEVVGKGLDKIKGLPTQIDQVLTALQLNGYLGDDMELIDSLSLPILMLASATENMGT
VVQIADKITEEERKAFIAAFLSAIFLIVPVIGEVVGSVAELTDIGTVMALLGAAGNSAVD
IYTVVDDPKNAPLAIFDLILAPLAIADIATITKVANIRRGMKESDIAKLGDPVKRRTDII
DKVKGVCRPDLE

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	359	710	5.2e-46	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	6.04e-168	358	706	2	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	2.07e-52	358	705	2	333	Glyco_18 domain.
395573	Glyco_hydro_18	3.11e-45	359	704	3	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.44e-37	359	605	2	272	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.58e-36	361	709	4	344	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ79373.1|CBM18|CBM50|GH18	0.0	1	1147	60	1280
UKZ53571.1|CBM18|GH18	0.0	304	1147	3	838
UKZ74675.1|CBM18|CBM50|GH18	0.0	1	711	64	856
UKZ48133.1|CBM18|CBM50|GH18	0.0	1	711	64	856
QGA18426.1|CBM18|CBM50|GH18	1.35e-310	1	1144	58	1306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y29_A	8.37e-31	359	708	10	353	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.04e-30	359	708	10	353	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
5WUS_A	6.78e-27	359	708	5	344	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	7.04e-26	359	708	5	344	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
1SR0_A	3.61e-24	359	708	4	337	Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides [Ovis aries],1ZBK_A Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution [Ovis aries],1ZL1_A Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation [Ovis aries],2DPE_A Crystal structure of a secretory 40KDA glycoprotein from sheep at 2.0A resolution [Ovis aries],2DSU_A Binding of chitin-like polysaccharide to protective signalling factor: Crystal structure of the complex formed between signalling protein from sheep (SPS-40) with a tetrasaccharide at 2.2 A resolution [Ovis aries],2DSV_A Interactions of protective signalling factor with chitin-like polysaccharide: Crystal structure of the complex between signalling protein from sheep (SPS-40) and a hexasaccharide at 2.5A resolution [Ovis aries],2DSW_A Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (SPS-40) with a pentasaccharide at 2.8 A resolution [Ovis aries],2FDM_A Crystal structure of the ternary complex of signalling glycoprotein frm sheep (SPS-40)with hexasaccharide (NAG6) and peptide Trp-Pro-Trp at 3.0A resolution [Ovis aries],2G41_A Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0A resolution [Ovis aries],2G8Z_A Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution [Ovis aries]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	4.02e-73	231	786	274	793	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q91XA9|CHIA_MOUSE	4.30e-24	343	709	9	368	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|Q6RY07|CHIA_RAT	7.68e-24	343	709	9	368	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q95M17|CHIA_BOVIN	1.02e-23	343	709	9	368	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q6TMG6|CH3L1_SHEEP	1.86e-23	359	708	4	337	Chitinase-3-like protein 1 OS=Ovis aries OX=9940 GN=CHI3L1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000004

TMHMM  Annotations     

Start	End
1035	1057
1064	1083
1093	1115