CAZyme Information: KAF5673671.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5673671.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	JAAQPE010000260|CGC1	104725.82	4.7634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000260:24884-28989(-)

Full Sequence      

MVQETSTSEPAASMPQTFERIADDLLPKLHRCIRLPQRIIKFEKASPSFFGVEARTVGHD
INELSSLSWGKGSGFILDFGLHMVGYLSFNLDYVGKNMDAPCRLRLTFGESPLDVTMDMN
DVNTWISTAWLPDEIINVDICPQTIILPRRYSFRYLRVQIIDTSPKFKVSFFKIQCESVS
AISQDHRMEAVEFSDPLLQDIDHVCISTLRDCMQTVFEDGPRRDRRLWIGDLRLQALTNY
STFRDFDLVKRCLFQFAAVRNKDGSLPACIFEKPTLTASTDYIADYDALFATIVYDYVEA
SGDTETGHLLWETVLDCPKRLLRNLNPTACVLEAERSKHHIFLDWAKGLDKSAGAHGVLL
YCLKVTNKLAVRLNKQPPYDELILKMTISATSFLKDGVFVSGGSQQISFASAAWLVLCEA
FPPEIARKALLATLAHPDAVKPLTPYLWHHVCDALATLGCYEECVDLIRSYWGGMVEAGA
DTFWECYDAENCMASPYGDDDAAGDGQGERHPRPPSQPEDALLWRVNYCEKSNSECRYDT
VDPVDRPFPFQPPKVTAKDLFSEGLDSILTWNVFPQEIDPIPVDNGSLMAMPDELPPISF
PELKRLQQCYLSTVHSVNPILDVAVLDQYITKVSENGLDWTTQTCLVALVCAIGALCQDP
LVETPKTHNSWDLEHTTDIAYSIWFMCNLQPLEAWRYFTMAGNSCYSAIWARESTMPSWP
GSTPSGPQAIKQSIFYTAYKSEVEIRYEIPSLPGSMLEHIEDRLTFPSPPAANCVFDETI
AWYYFLADIAARHLINRIVDAKVEISACPSEVQARSLLRSYEVFGSQLQDWYLSLPPEIS
FPPPVSTISPETNIYKRILRSRYLFIKELLCRPFVRLYLNYVLDLPSALDDDIVSIASLG
LQYCAWRLKAVDRMNKLDHGLWIWI

Enzyme Prediction     

EC	3.2.1.40:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	74	490	3.3e-51	0.8055555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	5.85e-15	194	488	9	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
213391	fungal_TF_MHR	6.30e-09	601	888	4	312	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62356.1|GH78	0.0	2	925	1	871
QGJ01450.1|GH78	0.0	14	925	1	977
QGI70559.1|GH78	0.0	14	925	1	977
CCT75250.1|GH78	0.0	14	499	1	486
CEI61989.1|GH78	0.0	1	499	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	2.99e-104	18	498	39	519	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	1.47e-18	74	490	193	602	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KAF5673671.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5673671.1.