CAZyme Information: KAF5672261.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5672261.1
• CAZy Family: GH13
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1462	JAAQPE010000279|CGC1	166269.78	6.2139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000279:3680-8917(+)

Full Sequence      

MPPIAQRTLLEKGWSFKKATDGHDAWKPVARVPTVAHIDLIDNGIIPDPFLDMNELKVEW
VGETAWTYRTTFDSPSANSRSVYLIFEGLDTFAQVKLNDIIILKSDNMFLSHRVDITNKL
SNDGSNVLSIDFDSALLKAREITKQYPDHRWELFNGEAGRLVVRKAQYHWGWDWGPVLNT
AGPWKPVWLEVSSAHINDFLLKYSVSPDLKKVQGTVEVDIEGPYDVANVCVHFQDNIVYN
MEAVKSSSGRLVIPFAIDQPQLWYPAGYGHQSQYTVSVSIVKDGQKLDGKIKKTGFRRSE
LVQRGDSHGKSFFFRINNIDIFCGGSCWIPADNFLPRITAAKYRDWLKLMIEGNQIMTRV
WGGGIYEDDAFYNCCDEMGILVWQDFMFGCGNYPVGPELIESIREEAVQNVSRLHHHPSV
VIYAGNNEDYQVQEQAGLEYNPDDKDPSSWLKSSFPARYYYEHLLPEAVSELSPGMIYWP
GSPFSGGKDTADKTTGDLHQWNVWHGTQEKYQVFDRLGGRFNSEFGMEAFPALSTIQHCI
TEECNRFPQSQMMDFHNKADGHERRIATYVVENFRPLPDLESHIYLTQLCQSEAMTFAYR
SWRRQWGDERRCGGVLVWQMNDCWPAISWSIVDYFLTKKPAYYSIRRALKPIAAGVQRQH
HDWSVVHARPAKTSLFEVWVANSKQEGVTVTVEIRFISISTGKDIRDKVVKANTVLIPNG
TTDILVGQIDHSKDEPHVISVSVLQGDICVSQDVDWPQPLKYLDFSDRGVEVQVRPDGYQ
LTANKPTKGLVFEELSGISLEDNCIDIMPGEVVNVKINGALEMSSTAVPDPSSGGSSDDN
TELIIAVVALVISVLAFVIAILQALQQYLATATGFSSCSEAVIGKWAQFARRRMIWSEFR
FEVQFEAPVIFVAKPSNTRGPLGDDALAKDESKKIIRLDGGNDNFKYTDTVKEFDNEYKQ
STQRIIHTADNEKATWYGLLMAIVRMEKESREWQGKKSAEWVKAAGPRPPIYTDEPHAYH
SLVVCMQRKRRTWDSMPKDFAKPYATTTISHLVEIAGMLGIHWRKFDLNTDQYRGQGNGF
VLYGSYTDGLGITFNFQKQGPTWFEKNRVIPNYNVKQLCFGMAPTIFNQEKKVYADEAKG
AESLQLGSLAEIAKTLVVLGCDINTVNYFRKPDQARHTHLFAVPFEILGMVGEMLHIKGT
VFRMLPNPTVFYWDPSSFSLSALMTEYINCLRPLHETALKDSEQVSKIIKWAEADEKFPL
LRTEGSTLDIFGEEINGANLVNHLNNLRSGVDLCDEYFGRMKKHGLSMIKRVVRMHIQEV
MGILHEKNEANDNTKNDDNDKTFDDTPLTIHDIDSAPGEDKETLLIQMYFDRVRQNVVRN
LSKQGLLSKRMKARQDSFVSEDDMSATRPKYGGRFGDKELNEAWCTLMFRMLCWLQLHDF
HKMDIHISKSDAYASRIPVYIA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	676	1.3e-93	0.6396276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.00e-74	3	646	8	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	2.36e-11	676	762	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	8.21e-09	194	297	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57951.1|GH2	0.0	1	824	1	824
CCT70824.1|GH2	0.0	1	825	1	824
QGI83791.1|GH2	0.0	1	825	1	824
QGI66550.1|GH2	0.0	1	825	1	824
QGI97440.1|GH2	0.0	1	825	1	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.76e-139	10	657	29	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	9.58e-111	11	824	21	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.81e-111	11	824	21	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.16e-110	11	824	19	837	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.31e-110	11	824	21	839	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCA0|MANBB_ASPTN	0.0	10	819	9	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q2TXB7|MANBB_ASPOR	0.0	10	819	9	829	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	0.0	6	819	5	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	0.0	6	819	5	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	10	819	9	829	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5672261.1.