CAZyme Information: KAF5671093.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5671093.1
• CAZy Family: GH12
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	JAAQPE010000297|CGC1	46992.53	9.4911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000297:9064-10378(-)

Full Sequence      

MHIPSLFSSALLFSIALALPQPDYSVTSAANHGKVAKYQKQCPFSIPHVKPHNQRYEHTI
NFPKGCESGKFINWKTYKANGVNLGAWLAKEKTHDPVWWNSLGTKAAATIDEWGLCQALG
KQCGPILEKRYESFLNTSTIDTLAKVGINTLRITTTYAAWVKVPGSAFYHGRQQDHLRKI
TRYAIERYNMHIIIGLHSLPGGVNNLDIGEAFGHDGWFYNSTNLAWSFKAVDKVLDFVKT
SGHKNAFTIAPLNEVSDNLAGFGSAAGLSDKATNWVLTYMNGVFQRVEAVDKRIPVMLQD
NFKGAAFWSPLFDKKRNLVIDSHVYYFAASGTYSQYVAPAVCGQAKYLAEGDQVPCVCRR
KTIFDTQRYAWQKYVAGGAFWTAVSYSTTPVDGQGIQRDYWSYVDLIRAGVITKATTKSY
C

Enzyme Prediction     

No EC number prediction in KAF5671093.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	131	394	9.5e-102	0.9964285714285714

CDD Domains     

KAF5671093.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64988.1|GH5_23	2.40e-301	1	421	1	437
QKD53692.1|GH5_23	4.83e-301	1	421	1	437
QGI92196.1|GH5_23	1.38e-300	1	421	1	437
QGI78478.1|GH5_23	1.38e-300	1	421	1	437
QGI61298.1|GH5_23	1.38e-300	1	421	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	1.63e-99	67	412	7	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	1.89e-97	68	410	11	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.22e-17	72	334	35	279	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q5AVZ7|EXGD_EMENI	3.56e-07	81	325	425	659	Glucan 1,3-beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgD PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999715	CS pos: 18-19. Pr: 0.9579

TMHMM  Annotations     

There is no transmembrane helices in KAF5671093.1.