CAZyme Information: KAF5667905.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5667905.1
• CAZy Family: CE4
• CAZyme Description: cutinase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		34115.99	6.6972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000346:681-1849(+)

Full Sequence      

MFSKSVLIALVPFAVAGPIAPRQGLGSGLGSGLGSGIPSFGLPSSGGDSTGGLPSIPSLG
SGGSIGGLPSIPGLGSGGSSGGIPSIPGLPSSGGSTGGLPSLPIGGGGSSFLPGGSTGGD
TTGDTSGDTSGSASTSAPASQPTGSTETPRAEGGSSTSPFGSLLGSAGGSSGGFGGSTQN
GLSGDCKDVTVIFARGTTEMGNVGTAAGPPFFQALAQQLGSDKVAVQGVEYAASVGGIMQ
MGDQAGSQKMASLVKEAYQKCPKTKVVMSGYSQGAMLVHNAAKSLPADTTSKIAAVVNFG
DPFQRQAIQGVPSDRVKIICHAGDGVCAGTAAITPDHLTYSQDANTAAQFVVSKVK

Enzyme Prediction     

No EC number prediction in KAF5667905.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	186	355	4.3e-48	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.53e-56	186	355	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI75372.1|CE5	4.78e-174	1	356	1	364
QGI89066.1|CE5	4.78e-174	1	356	1	364
QGI58153.1|CE5	4.78e-174	1	356	1	364
CCT61737.1|CE5	2.24e-173	1	356	1	368
QKD48196.1|CE5	2.34e-146	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.11e-45	186	355	79	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	3.40e-28	184	355	19	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
1AGY_A	5.11e-28	180	356	11	194	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]
1FFC_A	7.25e-28	180	356	25	208	Chain A, CUTINASE [Fusarium vanettenii]
1FFA_A	7.25e-28	180	356	25	208	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	1.32e-58	186	351	31	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	3.48e-52	186	351	31	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q9Y7G8|CUTI_PYRBR	2.06e-51	183	356	29	202	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	8.07e-47	177	355	57	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|A0A024SC78|CUTI1_HYPJR	4.84e-45	186	355	79	247	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999668	CS pos: 22-23. Pr: 0.9203

TMHMM  Annotations     

There is no transmembrane helices in KAF5667905.1.