CAZyme Information: KAF5665614.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5665614.1
• CAZy Family: GT90
• CAZyme Description: extracellular cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182	JAAQPE010000390|CGC1	19679.80	10.4369

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000390:52251-52861(-)

Full Sequence      

MAALRKTAGIDGSTCVFEDIWKDGANCGGCIQVSYKGKSLKIMVTNKTGGDKNHLDMTPA
TWSKLTNGMTGGGVDGIKWKWIACPLPKKSPLQVHMHGGASKYWFAATIENITHRVKAVE
VSSDSGKTWKATTLNDPNMWILKGTLPNDTAWVRVTSVNNKKVIVKNVALKSGVVTKATS
NF

Enzyme Prediction     

No EC number prediction in KAF5665614.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409004	DPBB_RlpA_EXP_N-like	3.16e-13	19	81	33	94	double-psi beta-barrel fold of RlpA, N-terminal domain of expansins, and similar domains. The double-psi beta-barrel (DPBB) fold is found in a divergent group of proteins, including endolytic peptidoglycan transglycosylase RlpA (rare lipoprotein A), EG45-like domain containing proteins, kiwellins, Streptomyces papain inhibitor (SPI), and the N-terminal domain of plant and bacterial expansins. RlpA may work in tandem with amidases to degrade peptidoglycan (PG) in the division septum and lateral wall to facilitate daughter cell separation. An EG45-like domain containing protein from Arabidopsis thaliana, called plant natriuretic peptide A (AtPNP-A), functions in cell volume regulation. Kiwellin proteins comprise a widespread family of plant-defense proteins that target pathogenic bacterial/fungal effectors that down-regulate plant defense responses. SPI is a stress protein produced under hyperthermal stress conditions that serves as a glutamine and lysine donor substrate for microbial transglutaminase (MTG, EC 2.3.2.13) from Streptomycetes. Some expansin family proteins display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs.
409008	DPBB_EXP_N-like	3.14e-10	18	84	39	117	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.
409010	DPBB_SPI-like	5.38e-08	21	81	41	101	double-psi beta-barrel fold of Streptomyces papain inhibitor and similar proteins. Streptomyces papain inhibitor (SPI) adopts a rigid, thermo-resistant double-psi-beta-barrel (DPBB) fold that is stabilized by two cysteine bridges. SPI serves as a glutamine and lysine donor substrate for microbial transglutaminase (MTG, EC 2.3.2.13) from Streptomycetes, that is used to covalently and specifically link functional amines to glutamine donor sites of therapeutic proteins. SPI is a stress protein produced under hyperthermal stress conditions, and is able to inhibit the cysteine proteases, papain and bromelain, as well as the bovine serine protease trypsin.
396087	Pollen_allerg_1	2.72e-07	94	166	2	75	Pollen allergen. This family contains allergens lol PI, PII and PIII from Lolium perenne.
215542	PLN03023	1.00e-05	20	130	66	189	Expansin-like B1; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50661.1|CBM63	1.54e-122	8	182	64	236
QOE88869.1|CBM63	8.92e-122	8	182	64	236
QGI93591.1|CBM63	3.63e-121	8	182	64	236
QGI62699.1|CBM63	3.63e-121	8	182	64	236
CCT66507.1|CBM63	3.63e-121	8	182	64	236

PDB Hits     

KAF5665614.1 has no PDB hit.

Swiss-Prot Hits     

KAF5665614.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5665614.1.