CAZyme Information: KAF5664947.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5664947.1
• CAZy Family: CE1
• CAZyme Description: feruloyl esterase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		29099.64	8.9731

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000402:68644-69525(+)

Full Sequence      

MKSLLTLTLALFASAGLGDAASAGCGKQPPSSGVKTMQVNGKNREYTLQLPNNYQNNKPH
RLVFGYHWLSGNMGNVVQGGYYGLRNLAGDSTIFIAPNGLNAGWANQGGEDITFTDQMLA
FAKQNLCIDEKQVFATGFSYGGAMSHSVACSRPNDFAAVAVISGALLSGCNGGNTPVSYL
HIHGSADNVLSIQQGRQLRDKWIGTNGCQQKTVNDPAPGATNYVKTSYTCSRKPVTWIGH
GGGHVADPTGNGQKFAPGETWSFFNAAAGTSAKLRC

Enzyme Prediction     

No EC number prediction in KAF5664947.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	201	5e-22	0.6167400881057269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	6.73e-21	15	272	18	312	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	8.11e-07	40	198	374	573	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223477	YpfH	4.02e-06	119	200	87	170	Predicted esterase [General function prediction only].
223489	DLH	1.69e-04	119	187	100	169	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
395257	Peptidase_S9	2.08e-04	93	161	16	95	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80928.1|CBM1|CE0	3.59e-132	1	269	1	270
CDP29168.1|CBM1|CE0	1.04e-129	6	269	6	270
CAP62092.1|CBM1|CE0	1.04e-129	6	269	6	270
QBZ61744.1|CBM1|CE0	3.15e-125	1	270	1	272
CCA72326.1|CBM1|CE0	2.19e-111	1	267	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	1.67e-06	41	198	18	176	C-terminal esterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XU32|FAEC_ASPFC	2.59e-85	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	2.59e-85	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|A1DI08|FAEC_NEOFI	3.67e-85	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	5.53e-82	7	267	11	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	1.04e-81	9	267	11	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999736	CS pos: 20-21. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in KAF5664947.1.