CAZyme Information: KAF5663839.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5663839.1
• CAZy Family: AA9
• CAZyme Description: pyranose 2-oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523		58237.21	6.5971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000424:11458-13466(-)

Full Sequence      

MVQKPTPSPSSASDTVHWEETDVLIVGSGPIGATFAHTLVKKGIKVTMIDIGQQETRRIG
DHKKNSVAVQKDISLFTNTVKNQLHGLLAYVLNGQNPAQKSYGNLPAAAATRVVGGMGSH
WTCCTPRQHKGIERSDLFSDGEWDTLYGRAEKLFTKTDDAFDDSVRQKLVKRVLSEAYPG
REMKSMPLACKRKHNNKEYVEWSCTATILGELSKPEYFYKGEERLFDMRPNTQCDKLELD
VDGQIAWALINDLETNQQYYIHAKKYVVCAGAVLTPGILHKSGLKSKLPALGHYLTEQPM
AFCQVVLDRKLVDSVEGEEIVKAHRESHENDPLPFPFNDPDPQVYFPLSEKYPWHTQIHR
DAFGYGEVPSNIDQRLVVDLRWFGYMKPDQENCVTFSNKTKDQFGMPQPTFNFVLDEEAE
ERCKRMITDMIEVARKLGGFLPGAEPKYLAPGSALHICGTYRAGSTPADSVVNKNGKAWG
VNDLVLGGCGVIPTQNACNPTLTAACFALAAADKIIEDLHVDQ

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	90	519	2e-193	0.8287795992714025

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	0.0	21	503	1	530	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
398739	GMC_oxred_C	1.14e-15	388	503	1	135	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	5.88e-14	19	503	6	521	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
223717	FixC	6.74e-05	19	63	2	42	Dehydrogenase (flavoprotein) [Energy production and conversion].
400379	Pyr_redox_2	8.06e-05	21	52	1	32	Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62719.1|AA3_4	0.0	1	523	1	545
CCT76068.1|AA3_4	0.0	1	523	1	545
QGI70943.1|AA3_4	0.0	1	523	1	545
QGJ01833.1|AA3_4	0.0	1	523	1	545
QGI88281.1|AA3_4	0.0	1	523	1	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F5V_A	1.84e-119	22	515	20	581	Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus Peniophora sp. [Peniophora sp. SG]
2F6C_A	1.84e-119	22	515	20	581	Chain A, Pyranose 2-oxidase [Peniophora sp. SG]
3BG7_A	2.90e-119	22	515	48	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
3BG6_A	4.09e-119	22	515	48	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
3BLY_A	4.09e-119	22	515	48	609	Chain A, Pyranose oxidase [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	2.93e-137	19	515	21	574	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	1.91e-124	22	519	37	603	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q8J136|P2OX_PENSG	2.10e-118	22	515	48	609	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	1.17e-117	22	515	48	609	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1
sp|Q5G234|P2OX_TRAPU	2.27e-117	22	515	48	609	Pyranose 2-oxidase OS=Trametes pubescens OX=154538 GN=p2ox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000032

TMHMM  Annotations     

There is no transmembrane helices in KAF5663839.1.