CAZyme Information: KAF5663599.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5663599.1
• CAZy Family: AA9
• CAZyme Description: mixed-linked glucanase precursor MLG1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1244	JAAQPE010000428|CGC1	134012.34	4.5728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000428:83424-88185(-)

Full Sequence      

MEFVTALRGTFDEQKPSLFEVLSEQQLNALLPPTLRYLLTIATHRHPRYLLRILNSFDEI
YAGVMLLVERHYLRTRGGSFAENFYGLKREKGLHAEVPRASMSSPDIVRETLKLTTRDVW
KNLLVIVGIPYLKRKLDESYEVNAPRALLGAAYTRMPDNPTLRDRFLYYYRWFLRNIYPS
VNAGYYFAMLAFNVAYLFDGSKYHSPLLWLIGTRIRRMSGADYKAIEALTQTPETGHRPG
WRSLLNPREMGPRVLSSLSILLPTSIFALKFLEWWYQSDFAKQLSRKATESVDLPPPVIS
ADGKGGSNKKKLEVKKEESNEGDSIPSAEDAPIATPSLLPVYTIPFPSDSALCPICVDEI
VTPTACQTGVVYCYTCIHKWIEGQHQKQEDFMESREGKWESGDSLISGFDWFNGRDLSNG
FVQYQDLEGAEQYGLYSVDPFSNTVRLRPDSARKFGLDEGRPSVRLESKESYQYGLFIAD
FQHMPISQCGTWPAFWAYGANWPNNGEVDILEGANLAYTNIMSAHTADGCMLDPADSNLF
SGKPQSLDCAVGTDNVGCGFTPPASDTSSYGDGFNAVGGGVYAMEWVSEYISIWHFPRGA
IPADIEAKRPDPRKWGLPQSLFGGSKCNVDEYFKDMRIVLNINFCGDYGEGTWGSSETCR
ALAPTCREYVANNPLDFQDAYFDVSYIDVYTRLGGDVPPVVPSSTSEAPTEISIPSASTP
GANTPISGNTRFPNSTAIVTRPRPKEDPSTTAEPTTTTTLTGISSVEVTIPGSGTNSATV
SSLPVATGGSSVNPAKIDDYAYLGCFGSQTGFQTFNEKAESDDMTIEKCIEACNGLTYIG
LFEGTCYCASKLDADTRALRNESSCNRPCPGNDGQFCGGMVAQRSKRSIPLRRDAPNNIL
LTVYADTSDAGQPDVPPGMGPGVDGTAAAGGSSSPTGGSGQGSSPADGVDGSTGSESQAR
NSAQETANGQAGSGDDLPGATNNRVVVDTATVTDVIAGTDAEAVVFSTLSSGEFLEATQA
IPDTVITSTITFFTVLPTNPGSLVPQESIVTMSYSLCDYCDTPTLIQPAMATKVVECDGC
GTNGENTVTLTVPVHVTVTVTGAGTNATQATGNAAAGIVPDQTREIPPIVPTGMGGKANA
GPEVTTIVITYLTTQLVTYGTETNSVSTETRTLRRTVVLTVSDIETMSILPVPSPGRPIT
PISHATPTPGASGAPAVVSSASSRVDDFFVYFAIVVMAILALSL

Enzyme Prediction     

No EC number prediction in KAF5663599.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	442	670	1.3e-79	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	3.25e-138	401	691	9	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
398431	Pex2_Pex12	1.31e-54	25	278	2	213	Pex2 / Pex12 amino terminal region. This region is found at the N terminal of a number of known and predicted peroxins including Pex2, Pex10 and Pex12. This conserved region is usually associated with a C terminal ring finger (pfam00097) domain.
396406	WSC	6.51e-17	803	879	1	80	WSC domain. This domain may be involved in carbohydrate binding.
185693	GH16_laminarinase_like	1.37e-10	428	690	27	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
214616	WSC	1.35e-08	799	879	1	85	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52728.1|GH16_1	0.0	1	1244	1	1243
CCT64076.1|GH16_1	0.0	402	1244	11	852
QGI77567.1|GH16_1	0.0	402	1244	11	852
QGI91274.1|GH16_1	0.0	402	1244	11	852
QGI60369.1|GH16_1	0.0	402	1244	11	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	1.56e-67	401	691	10	298	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	9.04e-64	402	690	11	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	9.32e-64	402	690	12	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	5.63e-63	402	690	10	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	5.98e-63	402	690	12	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VCP8|PEX12_EMENI	1.39e-139	1	405	1	440	Peroxisome assembly protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=PEX12 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	3.24e-68	409	692	35	316	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|Q9USW3|YHZ7_SCHPO	1.97e-65	402	690	137	417	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	2.89e-61	402	690	40	326	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	2.89e-61	402	690	40	326	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5663599.1.