CAZyme Information: KAF5659801.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5659801.1
• CAZy Family: AA5
• CAZyme Description: death-associated kinase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2258	JAAQPE010000535|CGC2	248869.92	6.5979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

Full Sequence      

MYSSSGRNLTSFRGETSDPTTFKPYDPETLDDARFIPNALDFAYRAFLADNAVTLSVPPV
FSNAQAVDSASFAGRGASFTVYRRRIPPQKTLTSRTNMDGLLIEIKDKRKLPEVVAYKVA
LIEFSDKGEATQTSRHAIDAAIMELYLSTHRPILQHPNLVDFLGLAWGANPFNSSQKLPV
LMVEFAEYGSLSQLQQREYLGVETRRKLCLDVCKGLHMLHSCGIAHGDIKAENALIFKDA
EHKYRAKVSDFGYSQVINAERDSLLLGGTRPWKAPEAKTAVKVSDAKYTDIYSLSLFIWC
TFALGQNIFKLFVNPSKKGDEFYAEAEKLKETRELAAQNDISTWYWKVITATTHGDTGQF
LQHFKSLQQQLEQLQQNTAQANRLEVGIDDIEKILCAIPPVSFQALEPLKQQLITTVRRL
GSYDAMKRAVTIGLSNEPQQRDLDQIMIALGHSGSFTEDSVEPNQVLKSNLNQHFFTWRH
WTGMDPSVQRYLTTTYIQRGEGEVKKGMINPPEAFLLTALYINGYGVDKNTSQAIRWLFN
AWGVKHPLASAYGYRIARAIGRTPDNPDSVIETLELMALRGSRTALEDLATLSKDTYDKT
KKTIRDVLGGTGANFFWKTEMLHGFAHNMWIRTFENIPIMLENFSQFDSIAEYTANKRGD
RILHVAASCGQTEAIRALLNHFPSLEVNQLNDQGETPLLCACRAGQHDTVMWLTSNGATA
SAARNGESPLHWLISFDDEEVESVGLSLIQAGADTNAKTTTFIAYQGSFPASLDVDRLPE
GYPIGWATHCSRPKIVKFLLSHTADPRMCNKSWPRARSALETAASQLRSECLELMIHAIE
YFNLEQGAEKHGGFLVTSLLQQAVYGTSLFDMILYHGPRYQQAMEYTFQCLLPRTSRVAS
PNGYGGFNQTLLYLAVSLARDELAEYLLKHGADVMKTGENYDEQILQSQDVGAFKTADIN
RACGIDLRTPLLEAVRWNRPTMVNLLLEHGAHATEASNNPFSGQASTWTALHVLAHAGQN
DTRLVQPLLDHGAPLDGFPDEVGKTESPLLVAMQRDLFQLADSFISHGADINLTSMSSGH
LSFTNPTTIFGHVIASNARNSISRLRYLLGRTDCLDFIVEPTRQWTALHRAAAAHIDVEF
RATDATEAAELDWTDIDWSANREIMNELLRQFDDPEQVGSVEGSMGLTAMHLAVLAGNDG
AVKLLLDKGARSDVRSADGKGPTAAEMVFGIQMERLSIIEEGARPGKEEVAALPMRLYGC
QSLAYTAAISAVLGQGISPLSDAVQGFAAPAAEYRPKFRYWLPDADVDHDVLKTDIQDLQ
KLGAGGLEFLPFYNYGFGGVNDSKMETYAFGKPAFRDVLQIALEATKANGLSMDVALGAS
QGQGVPSKPLTPGLAVQLVYGKVSVKGGEKFDGALPATDINWNENLGYIHPQEKFGGNRL
IGVSAAAVASKNASDESNIFVSLHEKSLVDLSNNVKNGKLTWTAPKDYKEYVLFAHYERY
TNQRSCDGVPTDVIANGSWVTDHFSAAGAKLASQFWEKNLLSTQIRQLLKDVGKHTWEDS
MEIQASLYWSPGFPDRFKSKRGYNVIKYLPLLFHKSTSFTAAQAPYNTTFYLDGTPDDGQ
SKYLQDYRLTLNDGYQEYLQTFEEWAESLGLSHSCQVGYNIPLDILADVPIVSTPELESL
AFKTPDQMSQFVSPAHLGRRNVISTEIGAVPQGAYSLTIPSLVNLFHDAFAGGVNAMMIH
GMTYTGEQLGSAWPGFTPFQYIYTELWSPKQPAWKYMGDMMNYTARNQFVLQQGVAKKDL
AFYLYKDPFGISDEYNGTDLRASGFTYEYLSPANFGSKVLKVTNKNLDSAGAGYRALVLD
QQQFITADASQKLVELADAGLPLVVIGDLPTTAIGTKGKDVVTRNISKLKGPKYSNIVFI
KSVDDLLNALDKLSVKPRVLTSSDAAKNLYTVWRSDKSSDYLFFFNKGPSASFEVTAEVE
HGKVPYRIDAWTGQQMAMASFKRPSGKISLQVSLKERQTAIVAFTSGKSKTSIVSQSKNV
LDASYGSDGKEGISVILGDAKEASLTLSNGQTKKIPAASSSGKKNALNIDISNWNLTLES
WVPGPNEAKSASVKKVMKLGTQKTLKPWSEISGAQNISGVGTYTATFRVAQLPSKDSIAV
LQFGPLLNTIRAWVNDKQLPAIDIYDAQVDVSDCLVKGSNTIRVEVASTLFNAVKARVDY
VKANGGGPAAPILYTSADWQKHGLIGPVSIRSLRKISL

Enzyme Prediction     

No EC number prediction in KAF5659801.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	1285	2250	3.4e-94	0.9927184466019418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407266	Glyco_hydro_106	6.10e-25	1430	1994	321	865	alpha-L-rhamnosidase.
270622	PKc	1.09e-22	154	317	48	204	Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.
270901	STKc_MAP3K-like	2.80e-21	153	299	46	182	Catalytic domain of Mitogen-Activated Protein Kinase (MAPK) Kinase Kinase-like Serine/Threonine kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily is composed mainly of MAP3Ks and similar proteins, including TGF-beta Activated Kinase-1 (TAK1, also called MAP3K7), MAP3K12, MAP3K13, Mixed lineage kinase (MLK), MLK-Like mitogen-activated protein Triple Kinase (MLTK), and Raf (Rapidly Accelerated Fibrosarcoma) kinases. MAP3Ks (MKKKs or MAPKKKs) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Also included in this subfamily is the pseudokinase Kinase Suppressor of Ras (KSR), which is a scaffold protein that functions downstream of Ras and upstream of Raf in the Extracellular signal-Regulated Kinase (ERK) pathway.
214567	S_TKc	3.82e-18	154	294	54	182	Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
270910	STKc_LKB1_CaMKK	4.01e-18	154	322	61	230	Catalytic domain of the Serine/Threonine kinases, Liver Kinase B1, Calmodulin Dependent Protein Kinase Kinase, and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Both LKB1 and CaMKKs can phosphorylate and activate AMP-activated protein kinase (AMPK). LKB1, also called STK11, serves as a master upstream kinase that activates AMPK and most AMPK-like kinases. LKB1 and AMPK are part of an energy-sensing pathway that links cell energy to metabolism and cell growth. They play critical roles in the establishment and maintenance of cell polarity, cell proliferation, cytoskeletal organization, as well as T-cell metabolism, including T-cell development, homeostasis, and effector function. CaMKKs are upstream kinases of the CaM kinase cascade that phosphorylate and activate CaMKI and CamKIV. They may also phosphorylate other substrates including PKB and AMPK. Vertebrates contain two CaMKKs, CaMKK1 (or alpha) and CaMKK2 (or beta). CaMKK1 is involved in the regulation of glucose uptake in skeletal muscles. CaMKK2 is involved in regulating energy balance, glucose metabolism, adiposity, hematopoiesis, inflammation, and cancer. The LKB1/CaMKK subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46519.1|GH106	QKD46519.1|GH106	0.0	1255	2258	1	1021
QGI59730.1|GH106	QGI59730.1|GH106	0.0	1255	2257	1	1009
QGI90645.1|GH106	QGI90645.1|GH106	0.0	1255	2257	1	1009
QGI76932.1|GH106	QGI76932.1|GH106	0.0	1255	2258	1	1010
CCT63273.1|GH106	CCT63273.1|GH106	0.0	1255	2258	1	1010

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SXR_A	3SXR_A	4.82e-12	154	314	60	211	Crystal structure of BMX non-receptor tyrosine kinase complex with dasatinib [Homo sapiens],3SXR_B Crystal structure of BMX non-receptor tyrosine kinase complex with dasatinib [Homo sapiens],3SXS_A Crystal structure of BMX non-receptor tyrosine kinase complexed with PP2 [Homo sapiens]
6I99_A	6I99_A	5.55e-12	154	314	70	221	Bone Marrow Tyrosine Kinase in Chromosome X in complex with a newly designed covalent inhibitor JS24 [Homo sapiens],6I99_B Bone Marrow Tyrosine Kinase in Chromosome X in complex with a newly designed covalent inhibitor JS24 [Homo sapiens]
4ITH_A	4ITH_A	7.39e-10	154	303	70	223	Crystal structure of RIP1 kinase in complex with necrostatin-1 analog [Homo sapiens],4ITH_B Crystal structure of RIP1 kinase in complex with necrostatin-1 analog [Homo sapiens],4ITI_A Crystal structure of RIP1 kinase in complex with necrostatin-3 analog [Homo sapiens],4ITI_B Crystal structure of RIP1 kinase in complex with necrostatin-3 analog [Homo sapiens],4ITJ_A Crystal structure of RIP1 kinase in complex with necrostatin-4 [Homo sapiens],4ITJ_B Crystal structure of RIP1 kinase in complex with necrostatin-4 [Homo sapiens]
6NYH_A	6NYH_A	7.54e-10	154	303	72	225	Structure of human RIPK1 kinase domain in complex with GNE684 [Homo sapiens],6NYH_B Structure of human RIPK1 kinase domain in complex with GNE684 [Homo sapiens]
7FCZ_A	7FCZ_A	7.62e-10	154	303	73	226	Chain A, Receptor-interacting serine/threonine-protein kinase 1 [Homo sapiens],7FCZ_B Chain B, Receptor-interacting serine/threonine-protein kinase 1 [Homo sapiens],7FD0_A Chain A, Receptor-interacting serine/threonine-protein kinase 1 [Homo sapiens],7FD0_B Chain B, Receptor-interacting serine/threonine-protein kinase 1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7T6X2|YR826_MIMIV	sp|Q7T6X2|YR826_MIMIV	1.78e-11	154	299	839	978	Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R826 PE=3 SV=2
sp|Q2MHE4|HT1_ARATH	sp|Q2MHE4|HT1_ARATH	2.01e-11	154	299	142	277	Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
sp|Q7T6Y2|YR831_MIMIV	sp|Q7T6Y2|YR831_MIMIV	5.22e-11	154	299	838	978	Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R831 PE=3 SV=2
sp|P97504|BMX_MOUSE	sp|P97504|BMX_MOUSE	7.76e-11	154	314	443	594	Cytoplasmic tyrosine-protein kinase BMX OS=Mus musculus OX=10090 GN=Bmx PE=2 SV=1
sp|P51813|BMX_HUMAN	sp|P51813|BMX_HUMAN	2.38e-10	154	314	467	618	Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999971	0.000076

TMHMM  Annotations     

There is no transmembrane helices in KAF5659801.1.