CAZyme Information: KAF5658785.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5658785.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1196	JAAQPE010000570|CGC1	132801.78	8.2072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000570:62476-66625(-)

Full Sequence      

MALSISRVSFEHYSSPLGIAETTPRISWRFDGDAPDWEQSSYDIQVIRSANDKPKAFSSK
SSDSLYQPWPDSPLEEAQPVSVRVRAHGRSKQPSTPWSDWVSVETGLFKKSWKNVKPIAS
TIKINITAPKRPVYFRKEFKLPDDIASARLYITALGIYEAEINGKRVGDSVLAPGWQSFH
HRHVYDTYDVTKLLNPGSNAIGALVGEGWYAGRLGFAGGQPNIYGNSTGILAQLHVKFKS
GKTVKIVTDTTWKSSFGPATAGEIYDGDKYNATLEADIKGWSKPGFKSSSWSDTRLLPFP
DGKLVPAEQPPVRRVEEVKPQRFFKSASGKQLVDFGQNLVGWLRLNVDGPKNTTIRLRHA
EVLEDGELALRPLRLAKAEDYLTLSGNGPIEWEPKFTFHGFRYAELHGWPKEAPLDENSV
RAIVVHTDLEETGYFNCSNPLLNKFRSNVRWSMKGNFLSIPTDCPQRDERLGWTGDAHAF
GPTSNYLYDTSAFWKGWHKDIWSEMSQNQMVPPMYVPSIPWFLDRPPKPASVWGDVVVGN
PWHIYKSFGDKAMLEEHLPQAQNWIDVGIPRNDVGLWNRSSFQFGDWLDPLAPPDDPGAA
TTDKHLVSDAYLIKMTETLSQIIGALGNSKLAKKYQTQHSDLKRQFQSSWAPDGKLVNRT
QAAYALSLAFDLLKDGKQKKAAADTLRDIIKTNDYLVGTGFAGTSQLGFALSDINLTDVF
YRMLLQEKVPSWLYQVVMGGTTTWERWDSMLPNGTINLGEMTSFNHYSFGSVANWMHQFI
GGIAPLEPGYKTVDIAPIPGGNLSHASATYVSQYGTISTDWTVTNGKFHLKVRIPPNTKA
KVTLPGTQETKTVGSGSLLFRNDPAAPTILVNGGHWSRTPCLQRRFGLITVIRHTTDTDI
TLHPIANNDMLSPARRPNIEVFDSGDFTNSIVSSWSFSRQHVSVFLGLISGGSMSDTVGW
RWSQNIVRFIFAFVLIAFTSYFEETLFPRFLFEGLQSPPLPSQKDEETAEKSTAGKKLEL
RPVLSQANGIADYFPKRSYRQILNLLGFPNIVIAAFIYAFGATAGIVSFNTISEILTEPP
YNFSTTNTGLVFFAALVGDTPGWGISVLSDQVVIALARRNGGIKELEMRLYMLIPCFVFA
AVGYMLYGWGTQTEAHWITIAIGIGAMISHQAGACKIATAYAMDCFPGISGELASG

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	325	844	1.9e-164	0.9940476190476191
CBM67	128	295	4.9e-37	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.60e-130	430	780	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	3.28e-75	144	316	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	2.63e-37	325	426	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.79e-23	782	856	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
340881	MFS_Tpo1_MDR_like	3.74e-14	1042	1188	176	314	Yeast Polyamine transporter 1 (Tpo1) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of fungal multidrug resistance (MDR) transporters including several proteins from Saccharomyces cerevisiae such as polyamine transporters 1-4 (Tpo1-4), quinidine resistance proteins 1-3 (Qdr1-3), dityrosine transporter 1 (Dtr1), fluconazole resistance protein 1 (Flr1), and protein HOL1. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, Flr1 confers resistance to the azole derivative fluconazole while Tpo1 confers resistance and adaptation to quinidine and ketoconazole. The polyamine transporters are involved in the detoxification of excess polyamines in the cytoplasm. Tpo1-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61506.1|GH78	0.0	1	856	1	856
CZS79492.1|GH78	0.0	1	860	1	863
CEI67932.1|GH78	0.0	1	856	1	859
CEF76201.1|GH78	0.0	1	860	1	863
UPL02850.1|CBM67|GH78	0.0	1	856	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	0.0	2	856	1	859	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.64e-167	112	874	292	1024	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.09e-129	11	856	38	910	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	9.65e-167	112	874	292	1024	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	2.38e-160	11	874	42	916	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	8.73e-151	11	845	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	4.72e-101	2	844	29	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
sp|O94343|YHMA_SCHPO	9.81e-14	942	1189	194	485	Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.10c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000025

TMHMM  Annotations     

Start	End
960	982
1045	1067
1087	1109
1130	1152
1157	1174