CAZyme Information: KAF5658440.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5658440.1
• CAZy Family: AA3
• CAZyme Description: mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003		110918.40	6.3050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000581:6961-10028(+)

Full Sequence      

MFYHGFGNYMKHAFPEDELRPLTCSPLTRDRENPAHIGLNDALGNYSLTLIDSLSTLAIL
AGGPEDASGTGSKALSDFQDGIADFVRHYGDGRPGVSGQGIRATGFDLDSKVQVFETVIR
GLGGLLSAHLFAIGELPIDGYTVQPAWATQADDPLELTPITWPNGFKYDGQLLRLALDLG
QRLLPAFYTDTGIPYPRVNLRHGIPFYTNSPLFRHMEGKPETVSGEITETCSAGAGSLTL
EFTVLSRLSGDVRFEQAAKRAFWAVWGRRSEIGLVGNGLDAEGGQWIGPHAGIGAGMDSF
FEYALKSHILLSGHGMPNKSTTSRQSSTEWLDPNVLHPPLPTELQTSEAFLDAWHLAHAS
VKRYLYTDRSHYPYYSNNHRTTGQPYTMWIDSLGAFYPGLLAMAGEVDEAVEANLVYTAL
WTRYAALPERWSVRENTVDQGLGWWPGRPEFIESTYYIYRATQDPWYLHVGEMVLRDIER
RCRAPCGWAGLQDVRTGELSDRMESFFLGETTKYMYLLFDPDHALNKVDAAFVFSTEGHP
LIIPKRSRQEPTRRHSLSKRVVPKNDTIDDSFTHSCPVPKVPGLSGSATAARPDLFSVAL
FVDLHNTPNVHGPLEAVEVFDRKKGHVTRYRAKTNHTMFPWTLPPTMLPQDGVCAAPVER
VMTWIEFPPGDTASSLVSRFGTSLVWYSHNGPTVRNLDGMRLQLEQQKGGKVADRYWRIT
HAASRELGRHENVFFHAEHVRSYKDDAFTCIRRKDIVEIDLLLDTPEKSNASAPAPAQGV
NVSSEVLPSHAALPSESLLKSLLRAVSSVFEPAYTDLPETETDGPGPTILRWTAYTSTGP
GAFPLPPIIDTPMVGSPSYNSRKPIANFPWKTVFLGGEACGAPLPESSSRQHQIIVIRRG
GCSFSEKLERIPSFPASPHTLQLVIVIDEGDDSEEGPDDIVRPLLTTAQVTPRGMGRLNG
VPLVLMRGAKGDYERFGEAKGVGMRRKYVVESQGMLIENAIVL

Enzyme Prediction     

No EC number prediction in KAF5658440.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	542	3e-141	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.48e-134	1	543	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.21e-58	1	545	79	520	glycoside hydrolase family 47 protein; Provisional
239038	PA_C_RZF_like	0.002	865	932	28	103	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46889.1|GH47	0.0	1	1003	1	1003
QGI59359.1|GH47	0.0	1	1003	16	1018
CCT62886.1|GH47	0.0	1	1003	51	1053
QGI90268.1|GH47	0.0	1	1003	16	1018
QGI76568.1|GH47	0.0	1	1003	16	1018

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	7.89e-34	1	543	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.67e-34	1	543	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	8.95e-34	1	543	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	2.60e-33	1	543	95	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	3.65e-33	1	543	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	4.11e-118	1	554	42	488	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	2.13e-111	1	551	132	589	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	3.41e-111	1	551	137	594	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	2.42e-98	1	561	42	520	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.00e-90	1	541	44	476	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000011

TMHMM  Annotations     

There is no transmembrane helices in KAF5658440.1.