CAZyme Information: KAF5657091.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5657091.1
• CAZy Family: AA13
• CAZyme Description: glycoside hydrolase family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28466.81	8.7590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000672:4249-5066(+)

Full Sequence      

MDSGQDTPLDFAMHITSYVSVAFAVLGLAAASPKGCATKRSPEPKLENGHYIVDRATKFA
NKKIWTFNGKSLPEGLYSSDYEVGNTHVFTPSGVKVRNGYLELTVPGGQKSKPYKAAEVA
TKIENIKYASVRTTAILSEPAGVCNGMFFYQSDSQETDIEWLSDPKSESNYNGIRRLWFT
NQDNNGDGKPTNKPVLPPANPTTTEHEYRIDWTKGLVEFYVDGVKQWSTKKDVPXGPPKQ
NAVFKIKKIEMYYNTA

Enzyme Prediction     

No EC number prediction in KAF5657091.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	236	3.2e-26	0.765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.86e-33	65	252	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185692	GH16_fungal_CRH1_transglycosylase	3.44e-05	148	225	66	137	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.56e-04	89	225	1	124	Glycosyl hydrolases family 16.
185693	GH16_laminarinase_like	2.11e-04	178	245	136	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	6.17e-04	12	240	5	231	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75335.1|GH16	1.70e-170	13	256	1	263
QGJ01524.1|GH16	8.09e-169	13	256	1	263
QGI70634.1|GH16	8.09e-169	13	256	1	263
QGI87979.1|GH16	9.43e-168	13	256	1	263
QKD62486.1|GH16	1.34e-167	13	256	1	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	7.24e-07	88	239	34	180	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A3DBX3|GUB_ACET2	6.42e-06	88	239	63	209	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.419501	0.580501	CS pos: 31-32. Pr: 0.5375

TMHMM  Annotations     

Start	End
10	32