CAZyme Information: KAF5656599.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5656599.1
• CAZy Family: AA11
• CAZyme Description: beta-1,2-xylosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		63766.54	6.1016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000731:19036-20785(-)

Full Sequence      

MNLFKEAPNQEGFPLQQCILARQSKTLEEAVQEYRRRYGIPPPPLFDEWFRFATDNDVKL
IDEFDMIHDLITPFWGLKPKTIRARAREALGFDNGLIGVSIRDHRITYIQNGVEWQQNAT
KRMMGKFLKYLPDMDLAFNFHDESRVILSHEDLTRLVKIAKEQNMPAASAKSQLANDFTQ
TNSELHDGKSFDEISLTRFNSFAHQSTWSHSRLSCPPDTPARCLEEGEAVDYRNRYGISD
LGFVYNTTAMSDICLSPSLKSNFGFFGGPNTYRIVQDLFPIFSQSKISSYSDLVYPSPWD
WAGMVKYDEDMDMEWAKKESKLYWRGSTTGGYSRNGRWRHQHRQRLVQKLNAHDQAHILT
KQDDHSWATSEVPRGDYNEMVDVHFSHIGQCDQGDCEAQRAFFNVTDTVDQQDAWSYKYL
LDMDGNAFSGRFTAFLRSRSLTFKLAVFREWHAEWLKPWAHYVPLSIQGDDWLETVRFLE
REEAGREEGERIAAASREWANQALRQVDMEAWFFRLMLEYARVIDDKREVIGYDRRSANM
KLPKVDS

Enzyme Prediction     

No EC number prediction in KAF5656599.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	257	524	1.6e-77	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.14e-18	280	522	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.16e-09	280	522	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51053.1|GT90	0.0	19	547	99	627
CCT66778.1|GT90	0.0	19	546	126	653
QGI93247.1|GT90	0.0	19	546	126	653
QGI62352.1|GT90	0.0	19	546	126	653
QGI79522.1|GT90	0.0	19	546	126	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.91e-07	269	535	107	354	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.57e-06	280	524	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.84e-47	19	544	168	676	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	2.77e-07	276	524	159	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.10e-06	269	524	135	370	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.10e-06	269	535	135	382	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	7.90e-06	269	535	135	382	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5656599.1.