CAZyme Information: KAF5655186.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5655186.1
• CAZy Family: AA1
• CAZyme Description: glycoside hydrolase family 3 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698		76633.99	5.2185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000853:4125-6221(-)

Full Sequence      

MWETTPIPRLNISSLKTSDGPAGVRGSRWTDGTHTTFIPCGISLAATFDPALVERIGGVL
GAEAKSKGAHVLLAPTMNISRSPFGGRNFENFGEDPFLTGTIASSYIGGVQSKGASACMK
HFVANDMETRRFNMEQTIDQRTLREIYLKPFQIALDANPLTAMTAYPKINGEHADTSRFL
VHDILRNEWDYQGLVMSDWGGLNSTVDSIRATTDLEMPRPPLRYGRALAKAVKDGQASEN
EHIDPSVRRLLNLLDKFHCLDNVNGRGEQNGDRSSSHVDIAADEGESDTPEFRQTAREAA
SQGIVLLENRQNLLLLQPSNIKKLGIIGPNAKNPTLGGTGSAIVNPYYTTNPCDSINSDA
KTINPDIEICYQRGIFTHLQPPLIGHCLTQPNSGSPGLQVDFFHGHEFIGDVVSTTYWQD
SLVYFMSDGDVPETLRGGKYCYKATGLLRPSVTDTYNFSLSNTGKAKLFIDEQLLIDNTE
WVEISGNFMNCGSVECFASLELEAGKTYHLRIDNAVVPPPTKPHDNTLFHKISGVRVGML
FQHDEETMFRDAVESARNADAVVLVVSHNNDTEREGSDRTSLSLPRRTDELVSEVCRVNS
NVVVVTQSACAISMPWAYEAGAILHAWYLGQECGNAVSDVILGHVNPSGKLPVTFPRKIE
DHGSHKWFPGDAANDKAEFGEGILVGYRWFDSEGLEPL

Enzyme Prediction     

No EC number prediction in KAF5655186.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	7	218	1.9e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.49e-72	7	339	55	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.55e-49	34	659	116	603	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.85e-46	544	687	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.11e-42	25	253	78	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.51e-32	7	655	76	588	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28473.1|GH3	0.0	1	698	32	723
QMW31943.1|GH3	2.00e-292	1	698	30	719
QMW43976.1|GH3	8.08e-292	1	698	30	719
BAE61700.1|GH3	1.32e-290	1	698	30	719
UDD60911.1|GH3	1.32e-290	1	698	30	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.17e-125	2	691	28	704	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.05e-121	2	691	28	704	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.20e-92	2	698	27	541	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	5.53e-80	7	698	87	703	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	3.54e-71	3	697	42	590	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NDE2|BGLI_ASPFN	8.22e-148	2	698	28	698	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	6.41e-147	2	698	28	698	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.37e-145	2	698	36	721	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A2R989|BGLI_ASPNC	2.41e-144	2	698	7	678	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	6.00e-144	2	698	28	699	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000005

TMHMM  Annotations     

There is no transmembrane helices in KAF5655186.1.