CAZyme Information: KAE8543292.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8543292.1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	CM018861|CGC1	91429.75	6.1303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018861:983550-986398(-)

Full Sequence      

MSNQAMDRSFLTASMEELVSMMSLGEKVSLLAGEDWWRTVAIPRLNIPSVKVTDGPNGAR
GESFFDMTPATVLPNATALAATFSPTLPGEAARLLAKETKARSAVCLLAPTVNICRSPLG
GRAFESFSEGPTLSGILAAKYINGLQSEGISATLKHFIANDQEHERMGQDAVIGERALRE
VYLRPFHIAQARADPWSYMTSYNKLNGTHCAEHPWLLKDLLRKEWGFDGLVMSDWMGTYS
VSEAINAGLDLEMPGKARWRQLQLVRQMVNAHKILPATIDERVINLLRWVQKMATLNPDI
VYERDDRKEWTRNEDREADAALVRKIGNEAIVLLKNENAVLPIKRGKVAVIGPNAKNSVI
TGGGSARLRPSWRATPWEGLVNNKPDDIELAYALGCKGSKFLPIFGSEFTSMDGETPGSF
DLLHYAIDASGKQASKPAVSQVWHNSDIMLADFRHPDLGEDYFTEVHALFTAPITGHWDF
EVSVTGQAWVYMDDQLVADLSKEQKRTSSFFGNGGNGTVFTVAVEKGTVYKFRLVHDSRK
PPLAPGQDSQPLQLIGMKLGSFPSISEDATIDEAVALAKESDTVVLVVGLDHDWESESYD
RPNLSLPLRLNELVHRVTTEAPNANKVVVLQTGSAVSMPWREHVDSVVWPWYGGNEAGNA
IADIIYGTVNPSGRLPLTLPERELGIAANLNFRSARTKTYYEEGIWVVSSPSNTPNDWRI
RVSAKVTNTGKVAGAHSVHFYVTPPPPTSNSLLHPEVTLQGFTKTGILPPGGTEKVSIEM
DKFAISHWDELTSTWRAESGQWLARIGRDAQTMCLQAPFEVPSGFKWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	254	1.9e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.22e-66	37	385	50	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.57e-58	44	820	101	763	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.19e-41	558	705	68	212	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.77e-40	11	781	49	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.97e-40	44	288	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78164.2|GH3	0.0	1	830	1	862
ADV25063.1|GH3	0.0	1	830	1	848
AUB23806.1|GH3	0.0	1	830	1	862
AFR94189.2|GH3	0.0	1	830	1	862
UKZ91447.1|GH3	0.0	1	830	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.61e-167	16	830	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.61e-163	16	830	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.19e-95	11	826	1	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.36e-76	19	817	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.58e-74	17	821	6	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	1.81e-184	14	830	13	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	6.57e-184	16	830	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	6.57e-184	16	830	7	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	6.57e-184	16	830	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.68e-183	16	830	7	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAE8543292.1.