CAZyme Information: KAE8542435.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8542435.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	CM018863|CGC8	46743.85	3.8819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018863:491489-492953(-)

Full Sequence      

MTSQDAQPTLSATTSLVFDASSAVSTSVSATASDEPSGTTSTSSLYATATTSTTASDNDN
QMDDDDDCEDETSSSIPSTTSHAATITSSTTFPISTAQDTDTLTSQIGDGLLAGHKSQTK
QWAGNDASTASITGPNASVSYAAATASSTTIKSSSTPTQMSEWTGPHYVIYADSWLGTMP
DVSELGYFNRFILAFWEATAGAVDNVQAWTSWDENYRNQVVEAYHEAGIAIMVAAFGSTD
LPTTSGKDAKQVAQELASFVKTYNLDGVDIDYEDMSAMNSAHAVAWIVEFQKELRTLLPS
PYIISHAPVAPWFTSANDYADGSYVSIHQQVGDTIDFYNVQFYNQGADQYVTCETLLTNA
GSEWSSTSVFEINSYTGVPLDKIVIGKPLGVNSASNGYMSASDLQVCVGEAKEKGWNGGI
MFWQWGDVSVHELVTRSV

Enzyme Prediction     

No EC number prediction in KAE8542435.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	187	391	1.4e-20	0.5101351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	5.92e-31	168	426	4	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	1.50e-16	235	423	83	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	3.72e-14	210	425	60	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
395573	Glyco_hydro_18	3.01e-12	243	397	83	230	Glycosyl hydrolases family 18.
226000	Chi1	8.30e-12	179	431	20	312	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22450.1|GH18	2.30e-234	2	435	113	547
KGB77976.2|GH18	4.06e-195	2	435	113	624
AAW43533.1|GH18	2.08e-181	2	435	113	579
AFR95478.1|GH18	1.87e-166	2	435	113	631
AUB25287.1|GH18	1.87e-166	2	435	113	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	5.06e-21	219	424	60	261	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
4RL3_A	2.65e-08	219	352	64	198	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]
3IAN_A	1.15e-07	213	399	65	257	Chain A, Chitinase [Lactococcus lactis subsp. lactis]
2Y8V_A	7.42e-06	254	344	115	199	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q838S2|CHI18_ENTFA	4.99e-07	213	399	102	294	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAE8542435.1.