CAZyme Information: KAE8541966.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541966.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		85939.06	4.2542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018865:1097016-1100284(-)

Full Sequence      

MSLFFSWTALFLLSLTAAQNITQTTSFSFSPTPVSTSVPSPTAPLDSIVPGQGNYPPVQA
LCAGGANVPFCPGILLQDVQLSGIFSDSKTFVDKPTVGTLNETLSAWDALGGNVTVGEVE
TFVEQYFKGEGLELSQVQLQNFVEDPAILGNIADPVFKAWIKVVNGYWTLLARETNQSAL
CNGNCVSSLIPLNHTIIVPGGRYREIYYWDSFWVLEGLLKSELYDYAWDLLQNFMDLIDI
YGFLPNGGRKYYLNRSQPPVFVQMIDAYIKTTNNVTILERALPVASAELQWWANNRTSNF
TSPFTNQSRIITQYSVTNSAPRPEGYAEDFETVMGASPALNETEQAELYSQLATGAESGW
DYSSRWCEQPLLNTTDNNPALRTLNIKSIIPVDLLSLMAGDHALNQLANMYELYANNTGG
EKYTDNEKKSKRDGQSGDDTASKVAYHRQMAQEYRDSILDLCWDSEKVRFGDPFGTEKGL
TEAIHTQSWFYDFNMTSSSRSDVFHPGGAWPLWQNITPSEIAGNESAALSFVSGFRFLLG
HYSGVPSVATLLLTGLNWDFPNAWPPHAYTSIKAFETLGRMLPNAIVLSNLTIPFDSVTK
NQLGLSESELQPQPQSTIGNVSLNTETSQDKPWPLALSIEFANRYLDAAFCSWYSTGGEI
SGLLTQLPLSDLNATGTYTAGQAGVMFEKFNVTDTDAAGGGGEYTVQIGFGWTNGVALWA
AGEYGQYIPAPTCPLIPILEINATSGSNTSDSSVYNATDEDRGPTASDTVKSASLFVGYR
IPRK

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	84	472	2e-97	0.7067209775967414

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	9.87e-100	84	725	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	5.98e-97	75	725	10	545	alpha,alpha-trehalase
224541	TreA	4.84e-55	75	718	61	546	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	1.36e-49	75	726	62	548	alpha,alpha-trehalase TreF.
237326	treA	8.66e-49	73	718	49	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76251.2|GH37	0.0	1	784	1	762
ADV23702.1|GH37	0.0	1	784	1	757
AAW44482.2|GH37|3.2.1.28	0.0	1	784	1	761
AFR96750.2|GH37	0.0	1	784	1	762
AUB26705.1|GH37	0.0	1	784	1	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.47e-54	76	725	22	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	5.52e-53	76	725	22	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	2.26e-46	73	718	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.65e-45	73	718	52	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	2.63e-43	73	718	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	6.96e-100	64	733	47	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	5.34e-85	70	730	46	574	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	1.79e-81	70	732	33	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|P32358|TREA_BOMMO	2.60e-80	70	752	27	572	Trehalase OS=Bombyx mori OX=7091 PE=1 SV=1
sp|O43280|TREA_HUMAN	4.04e-79	70	726	33	552	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999717	CS pos: 18-19. Pr: 0.9691

TMHMM  Annotations     

There is no transmembrane helices in KAE8541966.1.