CAZyme Information: KAE8541884.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541884.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	CM018865|CGC7	38121.67	3.8323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018865:858911-860388(-)

Full Sequence      

MILIPPSSWLLVISSLVTWTAAKPFPRNVRHGHCGLSSTSSVTVAEISEAATSPEETAST
VYSLNTQAASASATSSNNAATASSISTVTSVSLSSTFVYELDAQSVTSPEITTDTGLVVN
ADVYIVDGEGTSEDTIAQYHADGKTVICYFSAGTWEPNRSDAGNFDSACVCGPGGSFAGD
VCSSNENKLSGWNEWWLDIHSVSCISNVESIMSARISSFKAKGCDGVDPDNVDSFANSDQ
LHGNTADDQVNYLLWLSSTARSQGLMIDLKNAGSLLVDDNGDATSYQSEIIEAFDFAVIE
SCHEYEECNTYDSFLAAGKPEIQIEYGDITTCPSLQDGQHLLVYSQNSLSSALITLECD

Enzyme Prediction     

No EC number prediction in KAE8541884.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	117	326	1.6e-65	0.9421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.39e-70	97	326	2	191	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.56e-14	109	326	59	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76338.2|GH114	9.54e-227	1	359	1	359
ADV23543.1|GH114	1.74e-217	1	359	1	357
ALO69276.1|GH114	6.07e-200	1	359	1	359
AAW44548.2|GH114	9.40e-200	1	359	13	371
UOH83060.1|GH114	3.38e-199	1	359	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	6.13e-28	119	330	55	238	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	8.63e-28	119	330	72	255	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

KAE8541884.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000289	0.999680	CS pos: 22-23. Pr: 0.9688

TMHMM  Annotations     

There is no transmembrane helices in KAE8541884.1.