CAZyme Information: KAE8541709.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541709.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	CM018865|CGC3	95743.02	6.0769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018865:387946-390784(-)

Full Sequence      

MPYTPAYPSSYSDPEKGLPASPSSLARHMLVPRKPRWILGGLFICGVVLYYMNSNKHEKT
WGRGGSWDAQGDDSMVGWKPSDDKNEPLIYSDYTVDDQGNHFIKGWQQPITPMHPDVDLL
PRAPSIFPYLNISESEQPEEKIFPDSDLRQIISEPPELPEEQSNSMPEGAWSQKWSGPEV
WDQPRRGMKRVQWEGFAGGRDRWESENERKVREERKDAVKRGFKHAWEAYKRHAWGHDEI
RPVSLTASDPFNGWGATIVDSLDTLLLMGFSNEYNLCRPHINQLNFHWVNGRDWSEGYVS
EDLSGSGEVFALNRDKSVRLPVFETGIRYLGGLLGAYDLSGDDLLLERAIDLANVLSTAF
KTGSGLPIGRVDPGTKDEMIKLGTVSVAEVGSMSLELIRLAQITKDRKWFDLAQRAMDYI
RERVIPRGTHSPLIPMWFQPDAPLNTPMNGGLTFGGLADSYYEYLIKTYKLLGASEVSQV
WRDVYERSIDKAKETLYVDIDIVPGRDILAIGKLENGRLIPELEHLTCFIGAMLGLGAKL
LNRPGDMRDAERVTASCYWLSADTPTGLQPEVVEWYAPHETSVMYENVSISGGGKYHPLV
YSEKDFKGRDGMHRDRNGVLRWNGDNEPVLFADREKKKNPETPIKYGQRLKGTPTGARKV
STRGINRPETIESIFYMYRITGDRKWQEKGWKMFTSWMNTSTVDGGFSSVEDVTVSPVRF
SDNMESFALAETFKYHFLLQSEPDVLSLDDYVLNTEAHPLLTNPKLDPKAHTSHTRFWSP
PSSQDLGVRAQGTNVQKYARLEVIERASSPFRPPPPQNAPGGGGGRGMGGGGGKPGVIPE
LPPEVLKNRIN

Enzyme Prediction     

No EC number prediction in KAE8541709.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	223	760	5e-144	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.64e-177	223	760	2	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.67e-118	159	765	21	521	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	0.005	332	433	94	188	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23425.1|GH47	0.0	1	851	14	864
KGB76513.2|GH47	0.0	1	851	1	851
UOH82871.1|GH47	0.0	1	851	1	851
AFR96466.2|GH47	0.0	1	851	14	865
AUB26389.1|GH47	0.0	1	851	14	865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.23e-72	223	760	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.44e-72	223	760	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.52e-72	223	760	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	6.85e-72	223	760	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	1.10e-71	223	760	96	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	1.75e-69	223	760	257	693	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	8.95e-67	214	760	206	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	1.17e-65	214	760	207	652	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.92e-65	214	760	97	535	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	3.65e-64	211	772	93	546	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000012

TMHMM  Annotations     

There is no transmembrane helices in KAE8541709.1.