CAZyme Information: KAE8541470.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541470.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1578		170669.71	7.0862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

Full Sequence      

MLSSNPSVPLSSIDFADNEGRRLSLITAEGRKMLTAHDGLPSPGNLTPVTGGTPTENGSD
MWEGDIADERSRQMRYPDDDEDTLHTADMEQPGGAAAYMDNRGHRLSKVPSRGGIWHPDP
RWDENASSRRASPAARPIDGEQFFATHNKVNFPSHLAFTPAAAAPSSTSVNTTSPAPEAQ
EAQPRSQTAPPSPHHSPTATRQPSKHHHPLHDLRRFLNHTLGGRDKHANDHHHETSDPSS
PSSPSMNAATPGMQRRGSGFSGLAGTGGGGVNNTQATPAQTRHEKDHGAHTTHLMGFIRH
HHRDNDGEKSHTSLASFFGHGDKKDKKKKEKGHTPVESVAGSAAPSRTQTLQMTGADSPR
STSGSPSMTPADRSGYATPKNAAEYPGVPHPVVALTHPSLHEATHAALSKKYGKWGKVLG
SGAGGTVRLIKGSSKTGGSLYAVKEFRPRRQGETEKEYQRKVTAEFCVGVTLRHVNVIET
VDIVNDHNHFYEIMEYAPYDLFSVVMSGKMSRPEIYCVFRQIIDGVNYLHSMGLAHRDLK
LDNCVMTSENIVKLIDFGTATVFHYPGKHQIPATGVVGSDPYLAPEVLNKSQYDPRLTDV
WSCAIIFMCMILRRFPWKIPDYKTDMSFRLYVNTHPELCMKPPAPTPAPSLANGNDGGHA
KFGGPHGLLPDGSSSLPFRAESNASGETAVDTHKGSPDSPQKDNHLHDSPTSSSSGEAQL
AQLHLRDDNQEKHKDPSDLTFPRRSDSIVSVPASRYATKGGLAPVQPKRQGTLPPSRLTV
ADEHKGRSRAVSSPSSQPSTPAVDHRGNPMNAAAVGGAGPERKESTPESRAETQAKRERA
ASISSTRTFKSGGAESIFRLLPRESRSAIMRMLAVEPSIRCTLSDLLVGAGKDKMMCPCG
SEECSGSVAQPPAEITGLSADEEDDGDEWRSPGRKKEGDYWLDTSSIPQSMLRPRNNPAS
TQSPPEPDTPMSHYPSGHVHARPEAGTAAGANVGDHVEAEYFPGADHEAGAGDIHRRLNA
APAASVGTGEKMNVNERKGLAGRRKFGFTLKGLMGRKGKGSKFGLTQKGWMLVTVVVGLL
IFLKLIFSSEGSDYHHQTYDTAHLIPRDYLNHSLTDPAPFEFCPVFGPGDAIAAKRGQFE
LLRSRLHTGTGARVQRILQKAMSGAPITISILGGSVSACTGAGDDPTHEKCYPHRVFDWW
NTVFPHPANELTNGATPKTDSAYYAYCNSHHLPDKTDLVILEFDSADPNDPEWLQHFELL
VRSVLVRPEMPAVIILGHFSLQVQAQNGFAGPELLHNVVGQFYDVPHISTKGVLYEHYLG
TPDKARSAYYNDPNHPNFAGHDLIADVLISYLQSQICAGWSAVNGHGYDVPALGTEGDST
VAGTPSLLGGVGLRKGMPGQDPGDGSSAGSSLSDRYQGLRVPQIRLADRPHDVQLFREIE
PFCVAASDLVNPLPPTLFFGNGWATYHPPAKGNVVEDRHYWYADRPTARLRIPLKLGAGD
VGIYFLQSPPDKPLGVVKCWVDDNVAGAKELHGTAEVEDVIATLVMIDRGVERGSHFVEC
ELQGEPGGSSPPFKILGM

Enzyme Prediction     

EC	3.1.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	1172	1342	1.9e-23	0.9878787878787879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
270896	STKc_HAL4_like	1.17e-80	419	633	1	218	Catalytic domain of Fungal Halotolerance protein 4-like Serine/Threonine kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily is composed of HAL4, Saccharomyces cerevisiae Ptk2/Stk2, and similar fungal proteins. Proteins in this subfamily are involved in regulating ion transporters. In budding and fission yeast, HAL4 promotes potassium ion uptake, which increases cellular resistance to other cations such as sodium, lithium, and calcium ions. HAL4 stabilizes the major high-affinity K+ transporter Trk1 at the plasma membrane under low K+ conditions, which prevents endocytosis and vacuolar degradation. Budding yeast Ptk2 phosphorylates and regulates the plasma membrane H+ ATPase, Pma1. The HAL4-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
214567	S_TKc	2.32e-51	416	617	4	196	Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
270622	PKc	1.86e-46	419	623	1	209	Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.
270905	STKc_AMPK-like	6.02e-44	416	623	5	205	Catalytic domain of AMP-activated protein kinase-like Serine/Threonine Kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AMPK-like subfamily is composed of AMPK, MARK, BRSK, NUAK, MELK, SNRK, TSSK, and SIK, among others. LKB1 serves as a master upstream kinase that activates AMPK and most AMPK-like kinases. AMPK, also called SNF1 (sucrose non-fermenting1) in yeasts and SnRK1 (SNF1-related kinase1) in plants, is a heterotrimeric enzyme composed of a catalytic alpha subunit and two regulatory subunits, beta and gamma. It is a stress-activated kinase that serves as master regulator of glucose and lipid metabolism by monitoring carbon and energy supplies, via sensing the cell's AMP:ATP ratio. MARKs phosphorylate tau and related microtubule-associated proteins (MAPs), and regulates microtubule-based intracellular transport. They are involved in embryogenesis, epithelial cell polarization, cell signaling, and neuronal differentiation. BRSKs play important roles in establishing neuronal polarity. TSSK proteins are almost exclusively expressed postmeiotically in the testis and play important roles in spermatogenesis and/or spermiogenesis. The AMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
270687	STKc_CAMK	9.87e-41	416	606	5	190	The catalytic domain of CAMK family Serine/Threonine Kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CaMKs are multifunctional calcium and calmodulin (CaM) stimulated STKs involved in cell cycle regulation. There are several types of CaMKs including CaMKI, CaMKII, and CaMKIV. CaMKI proteins are monomeric and they play pivotal roles in the nervous system, including long-term potentiation, dendritic arborization, neurite outgrowth, and the formation of spines, synapses, and axons. CaMKII is a signaling molecule that translates upstream calcium and reactive oxygen species (ROS) signals into downstream responses that play important roles in synaptic function and cardiovascular physiology. CAMKIV is implicated in regulating several transcription factors like CREB, MEF2, and retinoid orphan receptors, as well as in T-cell development and signaling. The CAMK family also consists of other related kinases including the Phosphorylase kinase Gamma subunit (PhKG), the C-terminal kinase domains of Ribosomal S6 kinase (RSK) and Mitogen and stress-activated kinase (MSK), Doublecortin-like kinase (DCKL), and the MAPK-activated protein kinases MK2, MK3, and MK5, among others. The CAMK family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV99024.1|GT90	QRV99024.1|GT90	1.12e-171	1064	1578	643	1141
QRV84988.1|GT90	QRV84988.1|GT90	3.03e-171	1064	1578	643	1141
QRW26062.1|GT90	QRW26062.1|GT90	2.37e-142	1067	1578	286	750
UQT31642.1|CE17	UQT31642.1|CE17	2.25e-19	1153	1353	19	211
BCJ92770.1|CE17	BCJ92770.1|CE17	5.98e-19	1143	1353	9	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WAX_A	5WAX_A	5.07e-27	419	621	19	213	Crystal Structure of Sugarcane SAPK10 (serine/threonine-protein kinase 10) [Saccharum officinarum complex],5WAX_B Crystal Structure of Sugarcane SAPK10 (serine/threonine-protein kinase 10) [Saccharum officinarum complex]
3UDB_A	3UDB_A	6.57e-26	417	621	25	221	Crystal structure of SnRK2.6 [Arabidopsis thaliana],3UDB_B Crystal structure of SnRK2.6 [Arabidopsis thaliana],3UDB_C Crystal structure of SnRK2.6 [Arabidopsis thaliana],3UDB_D Crystal structure of SnRK2.6 [Arabidopsis thaliana],3UDB_E Crystal structure of SnRK2.6 [Arabidopsis thaliana],3UDB_F Crystal structure of SnRK2.6 [Arabidopsis thaliana]
4FSU_A	4FSU_A	4.52e-25	417	633	12	228	Crystal Structure of the CHK1 [Homo sapiens]
3UJG_A	3UJG_A	4.93e-25	417	621	24	220	Crystal structure of SnRK2.6 in complex with HAB1 [Arabidopsis thaliana]
1ZYS_A	1ZYS_A	5.37e-25	417	633	13	229	Co-crystal structure of Checkpoint Kinase Chk1 with a pyrrolo-pyridine inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59763|OCA2_SCHPO	sp|O59763|OCA2_SCHPO	9.68e-90	405	653	294	536	Serine/threonine-protein kinase oca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oca2 PE=1 SV=1
sp|Q08732|HRK1_YEAST	sp|Q08732|HRK1_YEAST	3.81e-79	408	631	210	434	Serine/threonine-protein kinase HRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRK1 PE=1 SV=1
sp|P22211|NPR1_YEAST	sp|P22211|NPR1_YEAST	2.69e-73	409	631	434	654	Nitrogen permease reactivator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPR1 PE=1 SV=2
sp|Q12100|RTK1_YEAST	sp|Q12100|RTK1_YEAST	1.09e-69	408	631	297	523	Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTK1 PE=1 SV=1
sp|Q12310|PRR2_YEAST	sp|Q12310|PRR2_YEAST	1.22e-66	402	656	350	602	Serine/threonine-protein kinase PRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRR2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000089

TMHMM  Annotations     

There is no transmembrane helices in KAE8541470.1.