CAZyme Information: KAE8541450.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541450.1
• CAZy Family: GH79
• CAZyme Description: DNA repair protein RAD51

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978		108491.36	6.2757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018866:1633609-1637634(+)

Full Sequence      

MSREQEQDPFVNQQGEEAEEEDFESLAPLLVAKLQEAGISAQDTKKLSDAGFHTVEAVAF
TPKKTLCTIKGISEQKADKILAEGRRVSCSGGGMVADFDDDGEACKMVPMGFTTATEIHS
RRSELVHITTGSTGLDTILGGGIETGAITELYGKTGKSQLCHTLAVTCQLPVSMGGGEGK
CLYIDTEGTFRPVRMLAVAERYGLDGEEVLDNIAYARAYNADHQLQLLVQASAMMAESRF
SLLIVDSCTSLYRTDFSGRGELSARQMHLAKFLRTLMRLADEFGVAVVVTNQVVAQVDGG
QFAVADAKKPIGGNIMAHASTTRLNLRKGRGTSRVCKIVDSPCLPEAEAIFAINPNGIGD
PEELQDYCRGGKSGEKRFRGCSDALLVVERLHLVVPFDFSLSPATAYPPPLQLPPVTRAL
YRAPLPPSLPAPAIPSSSFPVTRFSTDLSPTHPPMKPVGSLSLGRKLPSAGSLLVGILVG
LLVASLLRRGDSNTEAWRGSGVNKLRPNPVSGSSRLQRSQIMLPSLEQRLHILDLISTLS
AHHTKECLRNPQPLYVEQVKERYAPLVGYKQPWSNAGWLGRLFGGSDSHSSMASITGNDR
MDAIKRDLQARQHKYFFAINLYNSFDVIPDIFATLFRAAAILGYHNVFVSIYENGSNDQT
KALLKIFDALARTVGLRIIIRTSMRTRGLFNHRIEYLAEVRNAAMLPLHELRDNDGEVFD
SVVFMNDILPCVDDLLELIWQSRRQNAGITCAADYMYHDDIGAPVFYDNWVARDINGTAL
ENAPFEQIFHHTESNHRFQRHLPIQVQSCWNGIAVLDPTPFYEPPHVRFRMANLAQGECS
ASECSLICNDYFNAGYGRIIMVPRVKLAYDRKVWDIIHPERRNLTAIRGYKRIGGLPDDP
HTDPQDRSWYGPHDRLFTPEETEELEFVPGPEYVWCWGWDGAGDLDGPDVDPIWEHMQPR
SYSEEAIQIKHYRNMPGW

Enzyme Prediction     

No EC number prediction in KAE8541450.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	614	851	2.7e-85	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274048	recomb_RAD51	0.0	31	363	1	316	DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
185407	PTZ00035	0.0	27	363	19	337	Rad51 protein; Provisional
178728	PLN03186	2.15e-177	28	360	25	339	DNA repair protein RAD51 homolog; Provisional
410921	Rad51	2.35e-162	128	360	1	235	RAD51D recombinase. RAD51 recombinase plays an essential role in DNA repair by homologous recombination (HR). HR is an important error-free repair mechanism for chromosomal double-strand break (DSB) which otherwise leads to cell cycle arrest and death. RAD51 is recruited to the break site with the help of its paralogs, RAD51D, RAD51B, RAD51C, XRCC3, and XRCC2, where it forms long helical polymers which wrap around the ssDNA tail at the break which leads to pairing and strand invasion.
400636	Rad51	2.67e-159	110	361	1	255	Rad51. Rad51 is a DNA repair and recombination protein and is a homolog of the bacterial ATPase RecA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19894.1|GT69	0.0	455	978	1	524
AAW41198.1|GT69	0.0	455	978	1	525
AUB22329.1|GT69	0.0	455	978	1	525
AFR92851.2|GT69	0.0	455	978	1	525
UOH79682.1|GT69	0.0	455	978	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JZC_A	1.88e-157	24	363	18	339	helical filament [Homo sapiens],5JZC_B helical filament [Homo sapiens],5JZC_C helical filament [Homo sapiens],5JZC_D helical filament [Homo sapiens],5JZC_E helical filament [Homo sapiens],5JZC_F helical filament [Homo sapiens],5JZC_G helical filament [Homo sapiens],5NP7_A CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_B CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_C CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_D CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_E CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_F CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NP7_G CryoEM structure of Human Rad51 on single-stranded DNA to 4.2A resolution. [Homo sapiens],5NWL_A Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_B Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_C Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_D Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_E Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_F Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_G Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_H Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_I Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_J Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_K Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_L Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_M Crystal structure of a human RAD51-ATP filament. [Homo sapiens],5NWL_N Crystal structure of a human RAD51-ATP filament. [Homo sapiens]
5H1B_A	7.45e-157	24	363	18	339	Chain A, DNA repair protein RAD51 homolog 1 [Homo sapiens],5H1B_B Chain B, DNA repair protein RAD51 homolog 1 [Homo sapiens],5H1B_C Chain C, DNA repair protein RAD51 homolog 1 [Homo sapiens],5H1C_A Chain A, DNA repair protein RAD51 homolog 1 [Homo sapiens],5H1C_B Chain B, DNA repair protein RAD51 homolog 1 [Homo sapiens],5H1C_C Chain C, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJC_A Chain A, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJC_B Chain B, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJC_C Chain C, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJE_A Chain A, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJE_B Chain B, DNA repair protein RAD51 homolog 1 [Homo sapiens],7EJE_C Chain C, DNA repair protein RAD51 homolog 1 [Homo sapiens]
7C9A_A	1.64e-155	24	363	18	339	Human RAD51 post-synaptic complexes mutant (V273P, D274G) [Homo sapiens],7C9A_B Human RAD51 post-synaptic complexes mutant (V273P, D274G) [Homo sapiens],7C9A_C Human RAD51 post-synaptic complexes mutant (V273P, D274G) [Homo sapiens]
1SZP_A	5.39e-147	31	363	4	318	Chain A, DNA repair protein RAD51 [Saccharomyces cerevisiae],1SZP_B Chain B, DNA repair protein RAD51 [Saccharomyces cerevisiae],1SZP_C Chain C, DNA repair protein RAD51 [Saccharomyces cerevisiae],1SZP_D Chain D, DNA repair protein RAD51 [Saccharomyces cerevisiae],1SZP_E Chain E, DNA repair protein RAD51 [Saccharomyces cerevisiae],1SZP_F Chain F, DNA repair protein RAD51 [Saccharomyces cerevisiae]
3LDA_A	1.21e-145	31	363	83	397	Chain A, DNA repair protein RAD51 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99133|RAD51_USTMA	9.35e-167	24	361	18	337	DNA repair protein RAD51 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=RAD51 PE=3 SV=1
sp|P36601|RAD51_SCHPO	1.79e-159	28	364	44	361	DNA repair protein rhp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp51 PE=1 SV=1
sp|Q91917|RA51B_XENLA	3.10e-157	14	363	8	336	DNA repair protein RAD51 homolog B OS=Xenopus laevis OX=8355 GN=rad51-b PE=2 SV=1
sp|Q91918|RA51A_XENLA	6.17e-157	17	363	8	336	DNA repair protein RAD51 homolog A OS=Xenopus laevis OX=8355 GN=rad51-a PE=2 SV=1
sp|Q06609|RAD51_HUMAN	9.68e-157	24	363	18	339	DNA repair protein RAD51 homolog 1 OS=Homo sapiens OX=9606 GN=RAD51 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAE8541450.1.