CAZyme Information: KAE8541359.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541359.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742		83769.18	6.0048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018866:1349229-1352228(-)

Full Sequence      

MSGPQFDISRLSAAAISIQGRHFIDSHGRVLHLRGANVSAASKVPAFPPPKIHDHAQASY
VGRPFPLEEADEHWARLQSWGLTFVRITVTWDALEHKERGVYDEDYLAYLRALLQSMEPY
GLVAYIAIHQDVWSRYCGGSGAPGWTLEAAGFDLSNEGENLALSGAAFLDGIKSGRLAGE
RGLWPTGYQKLAAATMNTLFWGGETFAPSLKVATQVDGKWVSRNIQVYLQEAFLAATAKL
VKAVGDLETVMGFELMNEPHPGFIGLQSIHEWDYNTDLHLGQFPSPLQSFSMGAGHPTPN
VPVYTRSFPFPTRITSYVTANPEGACAWASKECPWEKHGVWRWSEVRKEPAVLQQDYFTK
NRDGGDVDFYEDLYFPFVRKWEQVIEENTTSTKGLKARMVEAIPNELCPEWKEESRPKNM
VYAPHWYDLNMLFKKKFGFMSVNVQGLARGMFVLRALYFGTAAAKANYALQIKTLVLAAR
LKLGPVPVIFGECGVPMDINNEEAFETGDWKWQERSMDALICAMEGALMGFNLWTYNPAN
RDDIGDDWNAENFSWYSESNRAKLLKNAEKGSDCLDVGARLLNVIVRPYPIATAGNPTSL
AYDARACTFTYRFRSPLRVSTAAPSPEEYTEIFLPRRVFRKESTEWTVTSGGKVHVDWDR
ERAFVWFEDSSLTAANIKEDMRSRRIDIWVTGQKVEESWSTAQILVTVMILLLAVLVAYY
AQLYEWEKDKMIFQHLREATGM

Enzyme Prediction     

EC	3.2.1.45:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	25	541	4.1e-176	0.9962894248608535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	4.07e-18	587	665	1	72	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19799.1|GH5_12	0.0	1	742	1	742
KGB75467.1|GH5_12	0.0	1	742	1	742
AAW41138.1|GH5_12	0.0	1	742	1	742
AFR92751.2|GH5_12|3.2.1.45	0.0	1	742	20	761
BAL46040.1|GH5_12|3.2.1.45	0.0	1	742	1	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	3.07e-66	22	635	27	712	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE12|EGCR1_CRYNH	0.0	1	742	1	742	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	3.90e-145	16	635	15	624	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	4.12e-83	16	651	6	698	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	3.98e-67	16	561	7	584	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000088	0.000000

TMHMM  Annotations     

Start	End
699	721