CAZyme Information: KAE8541097.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8541097.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47979.66	9.9612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018866:614882-616276(+)

Full Sequence      

MLRAKTSQIILVSLALHLALILYADHVDSHPERYGGLRYTDVDWRVVTDGARLIFNPSQE
EQAKGWLVKKTGFPIGDPYHRATFRYTPLLPLFLSPALIHPLLGKCLLALPSLLIPLLLL
SGPDSAPFWPTHLLWTINPLVLSITTRGSPEAAICFLVIALHYFLRLGSEDMKKGAGETS
AAIMLALAVSWKIYPAIYIPAVWKELSTRWGWFGARVWRFGFIAASSFVFINGILWSIEK
NRWGQPFLDHTYLYHLSRLDHRHNFSPYFYPIYLSFFPSPSASPLPSALLAVIRHPLTSF
LPQLTLILITSLSISSLDFAMFLQTALFVAFNKVCTSQYFTWFLPLLPPVIPQLHLSRRK
TLTLVIAWILAQGVWLGSAYLLELKAQSVYIVVWAAGLLVFGVGIYVLGNLIDGWAPPAR
TTKGKLN

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	144	412	4.4e-77	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	8.03e-56	144	412	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	4.75e-53	9	412	11	415	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75735.1|GT50	3.18e-295	1	427	1	423
ADV19492.1|GT50	1.10e-293	1	425	1	421
AUB22890.1|GT50	9.34e-274	1	426	1	421
AFR93356.1|GT50	9.34e-274	1	426	1	421
UOH81399.1|GT50	1.09e-272	1	426	1	421

PDB Hits     

KAE8541097.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7T310|PIGM_DANRE	6.76e-62	37	420	32	389	GPI mannosyltransferase 1 OS=Danio rerio OX=7955 GN=pigm PE=2 SV=1
sp|Q5F380|PIGM_CHICK	5.48e-60	18	423	20	413	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|Q4I073|GPI14_GIBZE	5.21e-57	5	422	9	416	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q54IA4|PIGM_DICDI	6.28e-56	6	412	25	427	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q66IJ4|PIGM_XENTR	2.09e-54	37	423	41	417	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999681	CS pos: 29-30. Pr: 0.8995

TMHMM  Annotations     

Start	End
89	111
181	203
216	238
271	293
300	322
361	383
390	412