CAZyme Information: KAE8540332.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8540332.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681		76983.43	4.8366

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018868:207601-212846(-)

Full Sequence      

MSFLRRLSSATSSFLSNPPNAQGLPLSSISHGPAENRRQSVPGGADKEKLARASWEIPDA
DSVMTRGLFISKKGLSGYASSSDFRKNSFDSVNADYHDCDSIDGSIGASSDEDTFVRDKY
DMMVHHLWNVGEREGWFRDMALDGVVSIRVRKRTFRTFPQPRSSRIKAKELITRIQEWDA
AISTLNPEVAMKISSKVVQAIMARCAATAIEIVLDVNTRIQILDDFTQLAGARKHQFAAF
IRSESCLVVWTDEVETLIPSAQALERRMIAYVWLGRHRELRLVDDAYDIIPTFRENEEGW
VDRDAEREKFFSEQMEETQVGAKDHEWEMRDRRPMMLYAPLVSGLAMIMTFAFIGSGIRG
SVNIFVFDDGMQLWDEEEREIRKAYYDRNNIGWTARPKHGQNGYIRKGRFKKASNMNFGI
RLSLRVEEIMDELRPIPNNSDDHDWVWTDDDERDIYNEALMQALEESNGVAWASGNIRIG
ELILIIDSDTRVPEDCFLDAASELNNSPNVAIIQHESAVMQVVGHFFENGITSFTTRINT
AISFCAANGEVAPFVGHNAFLRWSAIQDASFIDNEDGLRKCWSESHVSEDFDQALRLQMR
GWSLRWASYSNGGFQEGVSLTADDELRTAAWGAAERVLGEDASVAEFGQKVLDQLFSIAL
RPTVDSLYQFPRPSTHALALV

Enzyme Prediction     

No EC number prediction in KAE8540332.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	483	629	5e-43	0.6852791878172588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.05e-39	482	638	1	147	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	2.42e-05	480	590	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	2.60e-05	480	608	138	258	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
225494	MdoH	2.98e-04	470	631	223	392	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
133057	CESA_NdvC_like	6.07e-04	459	603	73	197	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ81467.1|GT0	8.79e-288	1	635	1	753
CED83368.1|GT0	5.73e-176	118	626	167	822
ACZ81448.1|GT0	6.33e-134	118	626	75	708
CCA68526.1|GT0	4.67e-116	118	637	4	645
CBQ70834.1|GT0	3.96e-110	116	637	54	700

PDB Hits     

KAE8540332.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9A6R5|OPGH_CAUVC	8.83e-06	468	631	226	389	Glucans biosynthesis glucosyltransferase H OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=opgH PE=3 SV=1
sp|B8GX72|OPGH_CAUVN	8.83e-06	468	631	226	389	Glucans biosynthesis glucosyltransferase H OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000016

TMHMM  Annotations     

Start	End
336	358