CAZyme Information: KAE8540076.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8540076.1
• CAZy Family: GH18
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		47325.85	9.6054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018869:1402194-1403638(+)

Full Sequence      

MVKLSPLALIFIAACFSRILHLTVLSGLSKALPLFDTSPSLLLSSPPPSLRWDAIHFSSI
AYNGYKYEQQVAFQPGWLAVMRLAGEGVRFIRAAPVIELKDVILGGTIMANFAFVAATLV
LYKLTKHTFNPIFALLTSLLYLLPPTAATSAPYTEPIYSLLTFSGVYLLSVKRQMALASL
CFAGATTVRSTGIFSSITLMCFAVFGDAHIFDLSNKDYFKRLIRKIWKPYLPALLVVAPF
LMFQYYCETVFCTRESKLANTARPWCSNSPPVSYGFVQKLYWNVGPFEYWTLAQLPNIAL
AMPILSSSLVGVVKFFSHMVSSSQVHNHGTEEKPPPPILFELYSVHLLTMALLLFTSHTQ
IALRVCLGDPVVWWNAVKLGFDNVEMDVARKGQVKINKFGRYWVGWTVVWGAIAAVLWAG
HYPPA

Enzyme Prediction     

No EC number prediction in KAE8540076.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	44	425	1.7e-96	0.8820638820638821

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.08e-31	52	425	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	9.99e-11	52	425	74	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB77682.1|GT76	2.41e-294	1	425	1	423
ADV21212.1|GT76	1.32e-287	1	425	1	425
EAL22094.1|GT76	9.98e-271	1	425	1	423
AAW42711.1|GT76	1.35e-268	1	425	1	423
UOH80020.1|GT76	2.84e-267	1	425	1	420

PDB Hits     

KAE8540076.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	1.77e-271	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	2.41e-269	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	7.21e-31	35	425	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	5.92e-27	51	374	65	415	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.25e-26	22	425	33	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.620962	0.379033

TMHMM  Annotations     

Start	End
7	29
103	122
129	148
152	171
192	211
231	253
399	421