CAZyme Information: KAE8539162.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8539162.1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652		73101.11	5.3354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018870:105245-108051(-)

Full Sequence      

MPNQRTRRSRDTSTSRTRKTVIVFLIILSLVLLGTVIVLSTVSYYLAIPSWAYLTESEVA
WRPEDVIKPLLEFPGPKLSKRMEWTEVVSEVPTYTTTGAASASAISVDSAAITAEIWDEF
KEEMEELDEVEEANEDDITEFEGEAVDSGSNVTSSIEEDGGQWGIDGMGSGSYWMRNNWD
GRVRDTDSWERLYNVTNRPGETIPRLIHQTWKNDQLPEKWRKAWKECREGMPDYEYMLWT
DDLSREFIATHYPAHLHMYDSYEFPIQRADSIRYFILHHFGGIYMDLDIGCRRRLDPLLQ
GDWEVILPITKPVGISNDLIFSSKGSAFMDGTVHGLAAFNHKYFSNYPTVMFSTGPMFLS
AQYAIFSASHPLTESHPRSEIRVLPKSLYGKNAPISEVPHSFFSHFYGSSWHADDAGFIT
FLGDWGKRLMWVGGAVLILGAIRLIWVKRKAATGQQYQLLSILPTTHSPSPSGYETPTSI
GSSPLSPEALNVNLSQNMPSDISSVFRRAGNLILAAPATLLQGADRERRGRRRQGLLYFV
PAIFQPLPGRRIRTASEASQMAVRRSKRDRDNRKDSLAPPPYDQLMEEGSASGSACPSPS
RPSNRLKAVVSGMGDATMEDVDAFLNEADNEGSGSGSGEGEDDAWWRSRRAS

Enzyme Prediction     

No EC number prediction in KAE8539162.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	219	300	1.9e-20	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.31e-45	201	419	80	288	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.85e-23	217	299	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76679.2|GT32	0.0	1	652	1	652
ADV23773.1|GT32	0.0	1	652	51	702
UOH84801.1|GT32	0.0	1	633	1	628
AUB28991.1|GT32	0.0	19	633	68	677
AFR98795.2|GT32	0.0	19	633	68	677

PDB Hits     

KAE8539162.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.09e-57	192	422	44	265	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.08e-56	196	460	55	317	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	1.17e-47	199	422	58	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.35e-47	180	416	32	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.44e-47	190	428	71	294	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999758	0.000260

TMHMM  Annotations     

Start	End
21	43
429	447