CAZyme Information: KAE8539075.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8539075.1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42570.70	8.8521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018871:2055328-2056716(-)

Full Sequence      

MSLKVPNRPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYSVTFSDFLCPEGKNHLF
TLKPYFWEVEPGKWEKRDGKRNPYCDKPGGQKQLETAAITIHNLALGAAYLPEFRNRCVQ
RLERILNVFFIDPETRMVPEVWYAQCNPGSKPLKGDYAFEIALRNIILVDQGMRLAASFL
NKRTVHNLANWIATQAKWIRDSDQGAAARKYEDNKRIWLEAITACHLSFISPPEGKSYAT
SFFQTYAPSHFPKKFFEHELQRTRPRHYTLFALEALFILAELTLPSSRRLDGHIAQYLRG
LLEFAKQVAPGEIERPLEEQGRYEGRWQWYERMLAGWTGQGERGGDEPDGRAWDGGFTQR
MRMIWGFI

Enzyme Prediction     

No EC number prediction in KAE8539075.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	57	283	7.4e-33	0.8243727598566308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.00e-14	53	282	11	238	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT67881.1|PL38	4.94e-21	26	275	44	300
UNE47223.1|PL38	8.27e-17	23	328	83	400
EGB14654.1|PL38	2.57e-15	61	280	98	322
CDS07499.1|PL38	2.91e-15	29	284	36	299
ABD80546.1|PL38	3.21e-14	56	282	110	340

PDB Hits     

KAE8539075.1 has no PDB hit.

Swiss-Prot Hits     

KAE8539075.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAE8539075.1.