CAZyme Information: KAE8538825.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538825.1
• CAZy Family: PL38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	CM018871|CGC7	41529.45	4.5730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018871:1339807-1340997(-)

Full Sequence      

MTLTTLPHPRLLPLILAVLFIIFALSSLLFRDYAPILNPIPNTFVRRERTQNPYSLFGCK
GNTISIQTVLDAGARFIAESSEHFDTVGAKRDLGIDIGGNWTLQSYADYLENTWHEFLVP
QGSNADHPTLQTVISYTSLLPREQEIETAIPKLIYTTDLLEPQQLPEQFQSWITQNPDWT
AMFVEDGQIDTWLERSLGSKGIKSKAQDELLALKEKWGVVRADLFRYLVLLLNGGVYTDT
DTASVLPIAQWARNPSVAAIAPLLTAIPQLISIIQDPSQSLFSTISTSEPSLIVAIESDA
LSTGANWREQSFTRGIQIVQWTIMANRGHPVLLDVIGMALRKCEEIRQMELNNGEVRKDD
VNILDWSGPGAL

Enzyme Prediction     

No EC number prediction in KAE8538825.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	5.29e-10	168	251	7	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	2.76e-09	147	332	79	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74945.2|GT32	1.16e-257	1	372	1	372
ADV21986.1|GT32	6.62e-243	1	372	1	352
AFR94929.2|GT32	9.41e-203	1	372	1	378
AUB24663.1|GT32	9.41e-203	1	372	1	378
UOH80832.1|GT32	9.55e-200	1	372	1	396

PDB Hits     

KAE8538825.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	9.70e-19	126	372	79	295	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.82e-14	219	370	196	314	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	5.33e-13	150	370	142	324	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	7.00e-12	147	372	93	348	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000030

TMHMM  Annotations     

Start	End
12	34