CAZyme Information: KAE8538576.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538576.1
• CAZy Family: GH105
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		35051.99	4.6393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018871:660149-661192(-)

Full Sequence      

MRPLTIANVVTLVTLASFFFSVLYYALSPSPLLPFDTLSPPNPEPNKPIGAPREAYVTFL
SNEDPYYFASARLLVFALQHDPLTADPSRPVIVLTTPSVPASYSRKLEAEGAIVIEKPLI
TSLPMVKTNPRWKDVYTKLWIFTLTSYDRLVYYDADHLVLRPVDSIWEAENSWPESGLAA
LGSGDGGYVEDSDYFLAGFFIAIPKEEIMEGLLAEKDYDPVFPEQNLMNKYFSRDGPRPW
APLDPIHERISPKYEHVEQGAHTIHEKCWQGWVERRLAELFYERLGRMEGYWLAKELNGT
IPTPDPYC

Enzyme Prediction     

No EC number prediction in KAE8538576.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	57	245	6.4e-20	0.7665369649805448

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.80e-63	54	297	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	3.00e-08	55	173	72	194	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	5.68e-07	34	239	3	229	galactinol synthase
133064	GT8_GNT1	1.41e-06	55	164	2	109	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	1.51e-04	127	232	75	197	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78671.1|GT8	1.21e-219	2	307	10	315
AAW46473.2|GT8	4.84e-210	2	306	10	314
AUB24114.1|GT8	9.35e-208	2	306	10	314
AFR94453.2|GT8	9.35e-208	2	306	10	314
ADV21652.1|GT8	2.27e-204	2	307	10	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3V90_A	1.21e-07	54	244	24	198	Structure of T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]
1ZCT_A	1.61e-07	54	244	24	198	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3USQ_A	1.62e-07	54	244	24	198	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3V8Y_A	1.62e-07	54	244	24	198	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
3USR_A	1.62e-07	54	244	24	198	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09680|YA0C_SCHPO	1.27e-10	58	269	76	340	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|Q4PSY4|GOLS7_ARATH	2.29e-07	51	250	16	235	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q9R062|GLYG_MOUSE	3.07e-07	54	244	4	178	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O22693|GOLS4_ARATH	3.08e-07	52	234	21	226	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|O43062|YGT9_SCHPO	6.20e-07	57	168	81	198	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000023

TMHMM  Annotations     

Start	End
5	27