CAZyme Information: KAE8538539.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538539.1
• CAZy Family: CE4
• CAZyme Description: dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	CM018871|CGC6	44395.31	10.0389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018871:532735-534174(-)

Full Sequence      

MSGQNPSSPALGQRKGLVSHGVDLVRALFFDRRYFWHTAFLLFLGEAALSLLVIWKIPYW
PAYMQQVDMFLAGERDYSKIEGETGPLVYPALHLYIYTAFHRLLPSIENVRPAQFVFLVF
YLATFLAVCTIYYLAGRPSNGGRHFPQVLLIPLTLSKRAHSIFLLRLFNDPIAMLIFYLS
VIAFQIGGRKGWRLGCVLFSLALGVKMNILNFLPGLLVLLFQYRGIVGTMEGLSIIGLIQ
FILPAPFFFAKSDPHLLKAYFTSAFDFSRQFLYEWTVNWRFISEEAFLSRERAVALLAGH
LTVLGLFAAFKWSPVPGGTLKVLQKGFSNPLNQALEVSQVPAYHIPLVLFSANLIGMLFA
RSLHYQFHSWYFHQLPFLLYSGAGWGNTLTR

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	40	382	4.6e-119	0.9175824175824175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	4.44e-157	40	381	1	329	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78711.1|GT58	5.52e-281	1	390	1	394
ADV21666.1|GT58	2.62e-279	1	390	1	394
AAW46504.1|GT58	1.57e-264	1	390	1	394
AFR94407.1|GT58	5.83e-260	1	390	1	394
AUB24060.1|GT58	5.83e-260	1	390	1	394

PDB Hits     

KAE8538539.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CN93|ALG3_CRYNB	1.19e-266	1	390	1	394	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ALG3 PE=3 SV=1
sp|P0CN92|ALG3_CRYNJ	2.79e-265	1	390	1	394	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ALG3 PE=3 SV=1
sp|Q9C1K8|ALG3_NEUCR	7.24e-76	42	380	40	374	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q55F69|ALG3_DICDI	1.60e-75	35	381	18	378	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q8K2A8|ALG3_MOUSE	2.20e-73	31	391	38	385	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000013

TMHMM  Annotations     

Start	End
33	55
115	137
162	184
196	218
228	250
293	310
342	364