CAZyme Information: KAE8538369.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538369.1
• CAZy Family: CE17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	CM018871|CGC10	48914.67	4.8558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018871:78430-79937(+)

Full Sequence      

MQIGSLVPLLALLAAPAFARSSVHPNAAAHRRQDIAHERVNSAVERREALAQTQPRALAE
KPKFKKITRRGARGCRAKNSTATASDAATAAAPSGNSTVAALNSTDTNVTSAVTSQAPVG
NTSSSSEIAAATASSIENLAALQQPSSSSSVSLSFDWSSSEASSQDHAQTGDSSTAASSS
SVASAAATSSAAATASSSNSTGSYTPNGIKAGISGDDPLSFLQGHIGWYYDWNASPSGSA
SGASPANMLWGAGSVDSTDASRLAAFKALSSTPEYIIGFEEPDCSTPGSSNIAVADGGSI
LLLMCEKMLKQKRSAASLWDSTIAPWKAKGSTLISPSMCHQAAEQYTQWLAGFSGQISTS
WDITNLHINKNSMDGVKADIDYYYTTYGKPIWVTEFACVDDSTGFVPCTDQSEINTFIND
IVDLFESDDRIQAYAYSTGEGLSSQWDMISNGALTESGQTYLSAISKYH

Enzyme Prediction     

No EC number prediction in KAE8538369.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	223	461	3.7e-49	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.35e-57	212	461	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	2.17e-79	205	469	7	254
UKZ69748.1|GH128	6.81e-78	205	469	7	254
QYT06237.1|GH128	4.53e-77	205	469	23	270
UKZ58231.1|GH128	6.40e-77	205	469	23	270
UKZ94447.1|GH128	1.20e-75	203	469	5	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	4.37e-198	21	469	22	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	1.63e-80	205	469	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAQ_A	1.23e-06	208	464	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	2.94e-06	208	464	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	7.03e-06	208	464	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	4.04e-09	220	463	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000671	0.999300	CS pos: 19-20. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in KAE8538369.1.