CAZyme Information: KAE8538161.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538161.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		51147.46	5.7824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=CM018872:248-1868(-)

Full Sequence      

MSIRAQGQDLLAACSQKKAARSARVSSWDHSGKNEDAFIVKPGESVILADIEGPGALTHL
WFVQACRRILGPGLIPYTKTGVAMMEVHPALGLVYEDNDPDYYRKVIIKMYWDDQEEPSV
LAPLGDFFCIGNSMPGNFESLPFSVSVKPSELHKFGGNCGANCYLTMPFNKRARIEIENQ
GDNPYIQYFYIDYELYKDPLPKDTLYFHAMWRRENPTNGWAPAGTQTNSLETQVKNLDGK
RNYVILETEGEGNFIGCNQSVSHFQGGDDMIFVDDDVWPPSFHGTGGEDYFSQGWGMQKN
AFSFAGSIIHEDDVPNTQVSYRWHLPDPVRFSKKIKVTMETGHGNHLRDDWSTTAYWYQT
LPGPKLSILPVEQRLPRRPIVPQDDVPQSAADDIDADQKALVQQREQRFKDYLADRQVWI
DRRAADSKHRAIKNREFAAEIRQRWLAGLN

Enzyme Prediction     

No EC number prediction in KAE8538161.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	103	359	1.2e-72	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	2.01e-104	104	359	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93243.1|GH172	1.19e-249	7	449	4	452
UPK94269.1|GH172	4.27e-248	7	449	8	456
CAK39208.1|GH172	7.15e-248	7	449	4	452
QKX59927.1|GH172	1.39e-241	7	449	6	455
QKD59092.1|GH172	9.12e-239	18	445	20	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	3.64e-159	18	442	15	443	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	4.98e-54	17	359	16	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

KAE8538161.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KAE8538161.1.